Histone Deacetylase 2/HDAC2 Antibody (10R7O1)

Novus Biologicals | Catalog # NBP3-15824

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10R7O1 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone Deacetylase 2/HDAC2 (NP_001518.3). MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGED

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Histone Deacetylase 2/HDAC2 Antibody (10R7O1)

Western Blot: Histone Deacetylase 2/HDAC2 Antibody (10R7O1) [NBP3-15824]

Western Blot: Histone Deacetylase 2/HDAC2 Antibody (10R7O1) [NBP3-15824]

Western Blot: Histone Deacetylase 2/HDAC2 Antibody (10R7O1) [NBP3-15824] - Western blot analysis of extracts of various cell lines, using Histone Deacetylase 2/HDAC2 antibody (NBP3-15824) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunoprecipitation: Histone Deacetylase 2/HDAC2 Antibody (10R7O1) [NBP3-15824]

Immunoprecipitation: Histone Deacetylase 2/HDAC2 Antibody (10R7O1) [NBP3-15824]

Immunoprecipitation: Histone Deacetylase 2/HDAC2 Antibody (10R7O1) [NBP3-15824] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug Histone Deacetylase 2/HDAC2 antibody (NBP3-15824). Western blot was performed from the immunoprecipitate using Histone Deacetylase 2/HDAC2 antibody (NBP3-15824) at a dilition of 1:1000.

Applications for Histone Deacetylase 2/HDAC2 Antibody (10R7O1)

Application
Recommended Usage

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Histone Deacetylase 2/HDAC2

Histone deacetylase 2 (HDAC2), or transcriptional regulator homolog RPD3 L1, is highly homologous to the yeast transcription factor RPD3 (reduced potassium dependency 3) gene. As in yeast, human HDA2 is likely to be involved in regulating chromatin structure during transcription. It has been implicated to associate with YY1, a mammalian zinc-finger transcription factor, which negatively regulates transcription by tethering RPD3 to DNA as a cofactor. This process is highly conserved from yeast to human.

Long Name

Histone Deacetylase 2

Alternate Names

HDAC2, YAF1

Gene Symbol

HDAC2

Additional Histone Deacetylase 2/HDAC2 Products

Product Documents for Histone Deacetylase 2/HDAC2 Antibody (10R7O1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Histone Deacetylase 2/HDAC2 Antibody (10R7O1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Histone Deacetylase 2/HDAC2 Antibody (10R7O1)

There are currently no reviews for this product. Be the first to review Histone Deacetylase 2/HDAC2 Antibody (10R7O1) and earn rewards!

Have you used Histone Deacetylase 2/HDAC2 Antibody (10R7O1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Notch Signaling Pathways Notch Signaling Pathway Thumbnail