Histone Deacetylase 4/HDAC4 Antibody (9A6E2)

Novus Biologicals | Catalog # NBP3-15463

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9A6E2 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone Deacetylase 4/HDAC4 (P56524). MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Histone Deacetylase 4/HDAC4 Antibody (9A6E2)

Western Blot: Histone Deacetylase 4/HDAC4 Antibody (9A6E2) [NBP3-15463]

Western Blot: Histone Deacetylase 4/HDAC4 Antibody (9A6E2) [NBP3-15463]

Western Blot: Histone Deacetylase 4/HDAC4 Antibody (9A6E2) [NBP3-15463] - Western blot analysis of extracts of various cell lines, using Histone Deacetylase 4/HDAC4 Rabbit mAb (NBP3-15463) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Histone Deacetylase 4/HDAC4 Antibody (9A6E2)

Western Blot: Histone Deacetylase 4/HDAC4 Antibody (9A6E2) [NBP3-15463] -

Western Blot: Histone Deacetylase 4/HDAC4 Antibody (9A6E2) [NBP3-15463] - Western blot analysis of various lysates, using Histone Deacetylase 4/HDAC4 antibody at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for Histone Deacetylase 4/HDAC4 Antibody (9A6E2)

Application
Recommended Usage

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Histone Deacetylase 4/HDAC4

Chromatin is a highly specialized structure composed of tightly compacted chromosomal DNA. Gene expression within the nucleus is controlled, in part, by a host of protein complexes which continuously pack and unpack the chromosomal DNA. One of the known mechanisms of this packing and unpacking process involves the acetylation and deacetylation of the histone proteins comprising the nucleosomal core. Acetylated histone proteins confer accessibility of the DNA template to the transcriptional machinery for expression. Histone deacetylases (HDACs) are chromatin remodeling factors that deacetylate histone proteins and thus, may act as transcriptional repressors. HDACs are classified by their sequence homology to the yeast HDACs and there are currently 2 classes. Class I proteins are related to Rpd3 and members of class II resemble Hda1p.

Long Name

Histone Deacetylase 4

Alternate Names

HDAC4

Gene Symbol

HDAC4

Additional Histone Deacetylase 4/HDAC4 Products

Product Documents for Histone Deacetylase 4/HDAC4 Antibody (9A6E2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Histone Deacetylase 4/HDAC4 Antibody (9A6E2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Histone Deacetylase 4/HDAC4 Antibody (9A6E2)

There are currently no reviews for this product. Be the first to review Histone Deacetylase 4/HDAC4 Antibody (9A6E2) and earn rewards!

Have you used Histone Deacetylase 4/HDAC4 Antibody (9A6E2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...