HLA DMB Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17866

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAPEPILRDWTPGL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HLA DMB Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: HLA DMB Antibody [NBP3-17866]

Immunocytochemistry/ Immunofluorescence: HLA DMB Antibody [NBP3-17866]

Immunocytochemistry/Immunofluorescence: HLA DMB Antibody [NBP3-17866] - Staining of human cell line EFO-21 shows localization to vesicles.

Applications for HLA DMB Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HLA DMB

HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail.

Alternate Names

class II histocompatibility antigen, M beta chain, D6S221E, DMB, major histocompatibility complex, class II, DM beta, MHC class II antigen DMB, MHC class II antigen HLA-DM beta chain, MHC class II HLA-DMB, Really interesting new gene 7 protein, RING7HLA class II histocompatibility antigen, DM beta chain

Gene Symbol

HLA-DMB

Additional HLA DMB Products

Product Documents for HLA DMB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HLA DMB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HLA DMB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HLA DMB Antibody - BSA Free and earn rewards!

Have you used HLA DMB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...