HLA DOA Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-43684

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HLA DOA Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HLA DOA Antibody - BSA Free

HLA DOA Antibody [Unconjugated] Immunohistochemistry-Paraffin: HLA DOA pAb [NBP3-43684]

Immunohistochemistry-Paraffin: HLA DOA pAb [NBP3-43684]

Staining of human tonsil shows strong cytoplasmic positivity in germinal and non-germinal center cells.

Applications for HLA DOA Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, pH 7.2, 40% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HLA DOA

HLA DOA, also known as HLA class II histocompatibility antigen DO alpha chain, is a 250 amino acid protein that is 28 kDa, found in lysosomes in B cells and controls HLA-DM-mediated peptide loading on MHC class II molecules. Current research is being done on several diseases and disorders including vogt-koyanagi-harada disease, alopecia universalis, alopecia, systemic lupus erythematosus, graft versus host disease, lupus erythematosus, rheumatoid arthritis, toxoplasmosis, autoimmune thyroiditis, leishmaniasis, myocarditis, diabetes mellitus, arthritis influenza, immunodeficiency, asthma, tuberculosis, thyroiditis, interferon, and hepatitis b. Interactions with the HLA DOA protein have shown to involve ENSG00000204252 and HLA-DMA proteins in immune response antigen presentation by MHC class II, G-protein signaling N-RAS regulation pathway, immune response IL-22 signaling pathway, immune response NFAT in immune response, immune response ICOS pathway in T-helper cell, phagosome, cell adhesion molecules (CAMs), antigen processing and presentation, intestinal immune network for IgA production,and type I diabetes mellitus pathway.

Alternate Names

HLA class II histocompatibility antigen, DO alpha chain, HLA-D0-alpha, HLA-DNAHLADZ, HLA-DZA, lymphocyte antigen, major histocompatibility complex, class II, DN alpha, major histocompatibility complex, class II, DO alpha, MHC class II antigen DOA, MHC DN-alpha, MHC DZ alpha

Gene Symbol

HLA-DOA

Additional HLA DOA Products

Product Documents for HLA DOA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HLA DOA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HLA DOA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HLA DOA Antibody - BSA Free and earn rewards!

Have you used HLA DOA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies