HMGCS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33907

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ASFFSFRVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HMGCS2 Antibody - BSA Free

Western Blot: HMGCS2 Antibody [NBP2-33907]

Western Blot: HMGCS2 Antibody [NBP2-33907]

Western Blot: HMGCS2 Antibody [NBP2-33907] - Analysis using Anti-HMGCS2 antibody NBP2-33907 (A) shows similar pattern to independent antibody NBP2-33908 (B).
Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33907]

Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33907]

Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33907] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33907]

Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33907]

Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33907] - Staining in human liver and cerebral cortex tissues using anti-HMGCS2 antibody. Corresponding HMGCS2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33907]

Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33907]

Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33907] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33907]

Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33907]

Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33907] - Staining of human cerebral cortex, kidney, liver and skeletal muscle using Anti-HMGCS2 antibody NBP2-33907 (A) shows similar protein distribution across tissues to independent antibody NBP2-33908 (B).
Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33907]

Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33907]

Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33907] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33907]

Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33907]

Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33907] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Applications for HMGCS2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HMGCS2

HMGCS2 is an enzyme that condenses acetyl CoA with acetoacetyl CoA to form HMG CoA, which is the substrate for HMG CoA reductase. Together with HMG CoA lyase, it is responsible for ketone body biosynthesis.

Alternate Names

3-hydroxy-3-methylglutaryl coenzyme A synthase, 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial), 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial), EC 2.3.3.10, HMG-CoA synthase, hydroxymethylglutaryl-CoA synthase, mitochondrial, mitochondrial 3-hydroxy-3-methylglutaryl-CoA synthase

Gene Symbol

HMGCS2

UniProt

Additional HMGCS2 Products

Product Documents for HMGCS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HMGCS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HMGCS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HMGCS2 Antibody - BSA Free and earn rewards!

Have you used HMGCS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...