HNRPDL Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57156

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HNRPDL Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to HNRPDL (heterogeneous nuclear ribonucleoprotein D-like) The peptide sequence was selected from the middle region of HNRPDL. Peptide sequence TMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HNRPDL Antibody - BSA Free

Western Blot: HNRPDL Antibody [NBP1-57156]

Western Blot: HNRPDL Antibody [NBP1-57156]

Western Blot: HNRPDL Antibody [NBP1-57156] - Titration: 1.0ug/ml Positive Control: Daudi cell lysate.
Immunohistochemistry: HNRPDL Antibody [NBP1-57156]

Immunohistochemistry: HNRPDL Antibody [NBP1-57156]

Immunohistochemistry: HNRPDL Antibody [NBP1-57156] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Immunohistochemistry-Paraffin: HNRPDL Antibody [NBP1-57156]

Immunohistochemistry-Paraffin: HNRPDL Antibody [NBP1-57156]

Immunohistochemistry-Paraffin: HNRPDL Antibody [NBP1-57156] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.
Immunohistochemistry-Paraffin: HNRPDL Antibody [NBP1-57156]

Immunohistochemistry-Paraffin: HNRPDL Antibody [NBP1-57156]

Immunohistochemistry-Paraffin: HNRPDL Antibody [NBP1-57156] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.

Applications for HNRPDL Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HNRPDL

HNRPDL belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRPDL has two RRM domains that bind to RNAs.

Alternate Names

A+U-rich element RNA binding factor, AU-rich element RNA-binding factor, heterogeneous nuclear ribonucleoprotein D-like, HNRNP, hnRNP DL, hnRNP D-like, JKTBP2, JKTBPJKT41-binding protein, laAUF1, Protein laAUF1

Gene Symbol

HNRNPDL

Additional HNRPDL Products

Product Documents for HNRPDL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HNRPDL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HNRPDL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HNRPDL Antibody - BSA Free and earn rewards!

Have you used HNRPDL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies