HOP Antibody (3D6) - Azide and BSA Free

Novus Biologicals | Catalog # H00084525-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 3D6

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

HOP (AAH14225, 1 a.a. ~ 73 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID

Specificity

HOP - homeodomain-only protein

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for HOP Antibody (3D6) - Azide and BSA Free

ELISA: HOP Antibody (3D6) [H00084525-M01]

ELISA: HOP Antibody (3D6) [H00084525-M01]

ELISA: HOP Antibody (3D6) [H00084525-M01] - Detection limit for recombinant GST tagged HOP is approximately 3ng/ml as a capture antibody.
ELISA: HOP Antibody (3D6) [H00084525-M01]

ELISA: HOP Antibody (3D6) [H00084525-M01]

ELISA: HOP Antibody (3D6) [H00084525-M01] - Detection limit for recombinant GST tagged HOP is approximately 3ng/ml as a capture antibody.

Applications for HOP Antibody (3D6) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: HOP

The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggested that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants encoding the same protein have been observed, the full-length nature of only some has been determined.

Alternate Names

CAMEO, HOD, homeodomain-only protein, HOP homeobox, HOPLAGYNECC1OB1SMAP31, Lung cancer-associated Y protein, MGC20820, not expressed in choriocarcinoma clone 1, Not expressed in choriocarcinoma protein 1, odd homeobox 1 protein, Odd homeobox protein 1, TOTO

Entrez Gene IDs

84525 (Human)

Gene Symbol

HOPX

OMIM

607275 (Human)

Additional HOP Products

Product Documents for HOP Antibody (3D6) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOP Antibody (3D6) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOP Antibody (3D6) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review HOP Antibody (3D6) - Azide and BSA Free and earn rewards!

Have you used HOP Antibody (3D6) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...