HOP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92003

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HOP Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MLIFLGCYRRRLEERAGTMSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HOP Antibody - BSA Free

Immunohistochemistry-Paraffin: HOP Antibody [NBP1-92003]

Immunohistochemistry-Paraffin: HOP Antibody [NBP1-92003]

Immunohistochemistry-Paraffin: HOP Antibody [NBP1-92003] - Staining of human cervix, uterine shows moderate positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: HOP Antibody [NBP1-92003]

Immunohistochemistry-Paraffin: HOP Antibody [NBP1-92003]

Immunohistochemistry-Paraffin: HOP Antibody [NBP1-92003] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: HOP Antibody [NBP1-92003]

Immunohistochemistry-Paraffin: HOP Antibody [NBP1-92003]

Immunohistochemistry-Paraffin: HOP Antibody [NBP1-92003] - Staining of human skin shows moderate positivity in stratum granulosum.
HOP Antibody - BSA Free Immunohistochemistry: HOP Antibody - BSA Free [NBP1-92003]

Immunohistochemistry: HOP Antibody - BSA Free [NBP1-92003]

Analysis in human skin and liver tissues using NBP1-92003 antibody. Corresponding HOPX RNA-seq data are presented for the same tissues.
HOP Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: HOP Antibody - BSA Free [NBP1-92003]

Chromatin Immunoprecipitation-exo-Seq: HOP Antibody - BSA Free [NBP1-92003]

ChIP-Exo-Seq composite graph for Anti-HOPX (NBP1-92003) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for HOP Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOP

HOP, also known as Homeodomain-only protein, has a 73 amino acid short isoform that is 8 kDa and a long 94 amino acid isoform that is 10 kDa; nucleus located; widely expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen; may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development; prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF; overexpression causes cardiac hypertrophy; and may also act as a tumor suppressor. Disease research is currently being studied with relation to choriocarcinoma, abdominal actinomycosis, nevus of ota, actinomycosis, lung cancer, nevus, carcinoma, squamous cell carcinoma, oral squamous cell carcinoma, esophageal squamous cell carcinoma, dilated cardiomyopathy, thyroid carcinoma, endometrial cancer, cardiomyopathy, gastric cancer, glioblastoma, esophagitis, and thyroiditis. This protein has shown an interaction with HDAC2, EPC1, SRF, GZMB, HOXB9, TLX3, and ZSCAN1 in the negative regulation of transcription from RNA polymerase II promoter, trophectodermal cell differentiation, transcription, DNA-dependent, regulation of transcription, DNA-dependent, and multicellular organismal development pathways.

Alternate Names

CAMEO, HOD, homeodomain-only protein, HOP homeobox, HOPLAGYNECC1OB1SMAP31, Lung cancer-associated Y protein, MGC20820, not expressed in choriocarcinoma clone 1, Not expressed in choriocarcinoma protein 1, odd homeobox 1 protein, Odd homeobox protein 1, TOTO

Gene Symbol

HOPX

Additional HOP Products

Product Documents for HOP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HOP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for HOP Antibody - BSA Free

Customer Reviews for HOP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HOP Antibody - BSA Free and earn rewards!

Have you used HOP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies