HOXB6 Antibody (8E3) - Azide and BSA Free

Novus Biologicals | Catalog # H00003216-M01-100ug

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 8E3

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

HOXB6 (NP_724779.1, 1 a.a. ~ 57 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSS

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for HOXB6 Antibody (8E3) - Azide and BSA Free

Western Blot: HOXB6 Antibody (8E3) [H00003216-M01-100ug]

Western Blot: HOXB6 Antibody (8E3) [H00003216-M01-100ug]

Western Blot: HOXB6 Antibody (8E3) [H00003216-M01-100ug] - Detection against Immunogen (32.01 KDa)
Western Blot: HOXB6 Antibody (8E3) [H00003216-M01-100ug]

Western Blot: HOXB6 Antibody (8E3) [H00003216-M01-100ug]

Western Blot: HOXB6 Antibody (8E3) [H00003216-M01-100ug] - Analysis of HOXB6 expression in transfected 293T cell line by HOXB6 monoclonal antibody (M01), clone 8E3. Lane 1: HOXB6 transfected lysate (Predicted MW: 25.4 KDa). Lane 2: Non-transfected lysate.
ELISA: HOXB6 Antibody (8E3) [H00003216-M01-100ug]

ELISA: HOXB6 Antibody (8E3) [H00003216-M01-100ug]

ELISA: HOXB6 Antibody (8E3) [H00003216-M01-100ug] - Detection limit for recombinant GST tagged HOXB6 is 0.03 ng/ml as a capture antibody.

Applications for HOXB6 Antibody (8E3) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: HOXB6

The HOXB6 gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor

Alternate Names

homeo box 2B, homeo box B6, homeobox B6, Homeobox protein Hox-2.2, Homeobox protein Hox-2B, homeobox protein Hox-B6, Homeobox protein Hu-2, HOX2, Hox-2.2, HOX2BHU-2

Entrez Gene IDs

3216 (Human)

Gene Symbol

HOXB6

OMIM

142961 (Human)

Additional HOXB6 Products

Product Documents for HOXB6 Antibody (8E3) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXB6 Antibody (8E3) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXB6 Antibody (8E3) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review HOXB6 Antibody (8E3) - Azide and BSA Free and earn rewards!

Have you used HOXB6 Antibody (8E3) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...