HOXB7 Antibody (5B2) - Azide and BSA Free
Novus Biologicals | Catalog # H00003217-M04
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot, ELISA, Sandwich ELISA, Knockdown Validated
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG1 kappa Clone # 5B2
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
HOXB7 (NP_004493, 55 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
Specificity
HOXB7 (5B2)
Clonality
Monoclonal
Host
Mouse
Isotype
IgG1 kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for HOXB7 Antibody (5B2) - Azide and BSA Free
Western Blot: HOXB7 Antibody (5B2) [H00003217-M04]
Western Blot: HOXB7 Antibody (5B2) [H00003217-M04] - Analysis of HOXB7 expression in transfected 293T cell line by HOXB7 monoclonal antibody (M04), clone 5B2. Lane 1: HOXB7 transfected lysatE (24 KDa). Lane 2: Non-transfected lysate.Western Blot: HOXB7 Antibody (5B2) [H00003217-M04]
Western Blot: HOXB7 Antibody (5B2) [H00003217-M04] - Western blot analysis of HOXB7 over-expressed 293 cell line, cotransfected with HOXB7 Validated Chimera RNAi or non-transfected control. Blot probed with H00003217-M04. GAPDH (36.1 kDa) used as loading control.
Sandwich ELISA: HOXB7 Antibody (5B2) [H00003217-M04] - Detection limit for recombinant GST tagged HOXB7 is approximately 0.1ng/ml as a capture antibody.
Applications for HOXB7 Antibody (5B2) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: HOXB7
Long Name
Homeobox B7
Alternate Names
HHO.C1, Hox-2.3, HOX2C
Entrez Gene IDs
3217 (Human)
Gene Symbol
HOXB7
OMIM
142962 (Human)
UniProt
Additional HOXB7 Products
Product Documents for HOXB7 Antibody (5B2) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for HOXB7 Antibody (5B2) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for HOXB7 Antibody (5B2) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review HOXB7 Antibody (5B2) - Azide and BSA Free and earn rewards!
Have you used HOXB7 Antibody (5B2) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...