HOXD9 Antibody (2A9) - Azide and BSA Free

Novus Biologicals | Catalog # H00003235-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 2A9

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

HOXD9 (NP_055028, 146 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RHYGIKPETRAAPAPATAASTTSSSSTSLSSSSKRTECSVARESQGSSGPEFSCNSFLQEKAAA*

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Specificity

HOXD9 - homeobox D9

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for HOXD9 Antibody (2A9) - Azide and BSA Free

Western Blot: HOXD9 Antibody (2A9) [H00003235-M01]

Western Blot: HOXD9 Antibody (2A9) [H00003235-M01]

Western Blot: HOXD9 Antibody (2A9) [H00003235-M01] - HOXD9 monoclonal antibody (M01), clone 2A9 Analysis of HOXD9 expression in NIH/3T3.

Applications for HOXD9 Antibody (2A9) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: HOXD9

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The exact role of this gene has not been determined.

Alternate Names

homeo box D9, homeobox D9, Homeobox protein Hox-4C, Homeobox protein Hox-5.2, homeobox protein Hox-D9, HOX4, Hox-4.3, mouse, homolog of, HOX4CHox-4.3, Hox-5.2

Entrez Gene IDs

3235 (Human)

Gene Symbol

HOXD9

OMIM

142982 (Human)

Additional HOXD9 Products

Product Documents for HOXD9 Antibody (2A9) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXD9 Antibody (2A9) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXD9 Antibody (2A9) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review HOXD9 Antibody (2A9) - Azide and BSA Free and earn rewards!

Have you used HOXD9 Antibody (2A9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...