HRPs (HDGF-related Proteins) and HDGF (Hepatoma-derived Growth Factor) are members of the HDGF family of proteins. There are currently six family members that vary widely in size. All lack a canonical signal sequence but appear to be secreted. In addition, family members possess a nuclear localization signal and a signature 90-100 amino acid, N-terminal hath region that contains a conserved PWWP motif.
HRP-2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-47437
![Immunocytochemistry/ Immunofluorescence: HRP-2 Antibody [NBP2-47437]](https://resources.rndsystems.com/images/products/HRP-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47437-img0003.jpg "Immunocytochemistry/ Immunofluorescence: HRP-2 Antibody [NBP2-47437]")
Loading...
Key Product Details
Validated by
Independent Antibodies
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AKKSAKKPQSSSTEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHSEIKFALK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for HRP-2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: HRP-2 Antibody [NBP2-47437]
Immunocytochemistry/Immunofluorescence: HRP-2 Antibody [NBP2-47437] - Staining of human cell line A-431 shows localization to nucleoplasm.![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]](https://resources.rndsystems.com/images/products/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0012.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]")
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human Small intestine shows strong nuclear positivity in glandular cells.![Immunohistochemistry: HRP-2 Antibody [NBP2-47437]](https://resources.rndsystems.com/images/products/HRP-2-Antibody-Immunohistochemistry-NBP2-47437-img0002.jpg "Immunohistochemistry: HRP-2 Antibody [NBP2-47437]")
Immunohistochemistry: HRP-2 Antibody [NBP2-47437]
Immunohistochemistry: HRP-2 Antibody [NBP2-47437] - Staining of human stomach, upper shows strong nuclear positivity in glandular cells.![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]](https://resources.rndsystems.com/images/products/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0004.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]")
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human cerebral cortex, colon, pancreas and testis using Anti-CTB-50L17.10 antibody NBP2-47437 (A) shows similar protein distribution across tissues to independent antibody NBP2-47438 (B).![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]](https://resources.rndsystems.com/images/products/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0005.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]")
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human testis.![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]](https://resources.rndsystems.com/images/products/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0006.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]")
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human pancreas.![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]](https://resources.rndsystems.com/images/products/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0007.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]")
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human cerebral cortex.![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]](https://resources.rndsystems.com/images/products/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0008.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]")
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human colon.![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]](https://resources.rndsystems.com/images/products/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0009.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]")
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human Cerebral cortex shows strong nuclear positivity in neuronal and glial cells.![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]](https://resources.rndsystems.com/images/products/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0010.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]")
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human cerebral cortex, gastrointestinal, pancreas and testis using Anti-CTB-50L17.10 antibody NBP2-47437 (A) shows similar protein distribution across tissues to independent antibody NBP2-47438 (B).![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]](https://resources.rndsystems.com/images/products/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0011.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]")
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human Pancreas shows strong nuclear positivity in exocrine glandular cells.![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]](https://resources.rndsystems.com/images/products/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0013.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]")
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human Testis shows strong nuclear positivity in cells in seminiferous ducts.Applications for HRP-2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: HRP-2
Long Name
Hepatoma-derived Growth Factor Related Protein 2, Isoform 1
Alternate Names
HDGF2, HDGFRP2, HRP2
Gene Symbol
HDGFL2
Additional HRP-2 Products
Product Documents for HRP-2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for HRP-2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for HRP-2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review HRP-2 Antibody - BSA Free and earn rewards!
Have you used HRP-2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...