HRP-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47437

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: AKKSAKKPQSSSTEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHSEIKFALK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HRP-2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: HRP-2 Antibody [NBP2-47437]

Immunocytochemistry/ Immunofluorescence: HRP-2 Antibody [NBP2-47437]

Immunocytochemistry/Immunofluorescence: HRP-2 Antibody [NBP2-47437] - Staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human Small intestine shows strong nuclear positivity in glandular cells.
Immunohistochemistry: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry: HRP-2 Antibody [NBP2-47437] - Staining of human stomach, upper shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human cerebral cortex, colon, pancreas and testis using Anti-CTB-50L17.10 antibody NBP2-47437 (A) shows similar protein distribution across tissues to independent antibody NBP2-47438 (B).
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human testis.
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human pancreas.
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human colon.
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human Cerebral cortex shows strong nuclear positivity in neuronal and glial cells.
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human cerebral cortex, gastrointestinal, pancreas and testis using Anti-CTB-50L17.10 antibody NBP2-47437 (A) shows similar protein distribution across tissues to independent antibody NBP2-47438 (B).
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human Pancreas shows strong nuclear positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437]

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human Testis shows strong nuclear positivity in cells in seminiferous ducts.

Applications for HRP-2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HRP-2

HRPs (HDGF-related Proteins) and HDGF (Hepatoma-derived Growth Factor) are members of the HDGF family of proteins. There are currently six family members that vary widely in size. All lack a canonical signal sequence but appear to be secreted. In addition, family members possess a nuclear localization signal and a signature 90-100 amino acid, N-terminal hath region that contains a conserved PWWP motif.

Long Name

Hepatoma-derived Growth Factor Related Protein 2, Isoform 1

Alternate Names

HDGF2, HDGFRP2, HRP2

Gene Symbol

HDGFL2

Additional HRP-2 Products

Product Documents for HRP-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HRP-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for HRP-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HRP-2 Antibody - BSA Free and earn rewards!

Have you used HRP-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...