HRSP12 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82452
![Western Blot: HRSP12 Antibody [NBP1-82452]](https://resources.rndsystems.com/images/products/HRSP12-Antibody-Western-Blot-NBP1-82452-img0010.jpg "Western Blot: HRSP12 Antibody [NBP1-82452]")
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGP
Reactivity Notes
Reactivity reported in scientific literature (PMID: 22801372)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for HRSP12 Antibody - BSA Free
![Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452]](https://resources.rndsystems.com/images/products/HRSP12-Antibody-Immunohistochemistry-Paraffin-NBP1-82452-img0021.jpg "Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452]")
Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452]
Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452] - Staining of human skin shows no positivity in squamous epithelial cells as expected.![Western Blot: HRSP12 Antibody [NBP1-82452]](https://resources.rndsystems.com/images/products/HRSP12-Antibody-Western-Blot-NBP1-82452-img0008.jpg "Western Blot: HRSP12 Antibody [NBP1-82452]")
Western Blot: HRSP12 Antibody [NBP1-82452]
Western Blot: HRSP12 Antibody [NBP1-82452] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate![Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452]](https://resources.rndsystems.com/images/products/HRSP12-Antibody-Immunohistochemistry-Paraffin-NBP1-82452-img0015.jpg "Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452]")
![Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452]](https://resources.rndsystems.com/images/products/HRSP12-Antibody-Immunohistochemistry-Paraffin-NBP1-82452-img0016.jpg "Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452]")
Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452]
Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452] - Staining of human fallopian tube, kidney, liver and skin using Anti-HRSP12 antibody NBP1-82452 (A) shows similar protein distribution across tissues to independent antibody NBP1-82453 (B).![Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452]](https://resources.rndsystems.com/images/products/HRSP12-Antibody-Immunohistochemistry-Paraffin-NBP1-82452-img0017.jpg "Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452]")
Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452]
Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452] - Staining of human Fallopian tube shows no positivity in glandular cells as expected.![Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452]](https://resources.rndsystems.com/images/products/HRSP12-Antibody-Immunohistochemistry-Paraffin-NBP1-82452-img0018.jpg "Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452]")
Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452]
Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.![Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452]](https://resources.rndsystems.com/images/products/HRSP12-Antibody-Immunohistochemistry-NBP1-82452-img0019.jpg "Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452]")
Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452]
Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82452] - Staining of human liver shows weak to moderate cytoplasmic and nuclear positivity in hepatocytes.Applications for HRSP12 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: HRSP12
Alternate Names
EC 3.1, heat-responsive protein 12perchloric acid-soluble protein, p14.5, PSPribonuclease UK114, translational inhibitor protein p14.5,14.5 kDa translational inhibitor protein, UK114 antigen homolog, UK114translational inhibitor p14.5
Gene Symbol
RIDA
Additional HRSP12 Products
Product Documents for HRSP12 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for HRSP12 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for HRSP12 Antibody - BSA Free
Powered by Bioz
Customer Reviews for HRSP12 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review HRSP12 Antibody - BSA Free and earn rewards!
Have you used HRSP12 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...