HSBP1 Antibody (2C3) - Azide and BSA Free

Novus Biologicals | Catalog # H00003281-M02

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2C3

Format

Azide and BSA Free
View all HSBP1 Primary Antibodies »

Product Specifications

Immunogen

HSBP1 (AAH07515, 1 a.a. ~ 76 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQKS

Specificity

HSBP1 - heat shock factor binding protein 1

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for HSBP1 Antibody (2C3) - Azide and BSA Free

Western Blot: HSBP1 Antibody (2C3) [H00003281-M02]

Western Blot: HSBP1 Antibody (2C3) [H00003281-M02]

Western Blot: HSBP1 Antibody (2C3) [H00003281-M02] - Detection against Immunogen (34.1 KDa).

Applications for HSBP1 Antibody (2C3) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: HSBP1

The heat-shock response is elicited by exposure of cells to thermal and chemical stress and through the activation of HSFs (heat shock factors) results in the elevated expression of heat-shock induced genes. Heat shock factor binding protein 1 (HSBP1), is a 76-amino-acid protein that binds to heat shock factor 1(HSF1), which is a transcription factor involved in the HS response. During HS response, HSF1 undergoes conformational transition from an inert non-DNA-binding monomer to active functional trimers. HSBP1 is nuclear-localized and interacts with the active trimeric state of HSF1 to negatively regulate HSF1 DNA-binding activity. Overexpression of HSBP1 in mammalian cells represses the transactivation activity of HSF1. When overexpressed in C.elegans HSBP1 has severe effects on survival of the animals after thermal and chemical stress consistent with a role of HSBP1 as a negative regulator of heat shock response.

Alternate Names

DKFZp686D1664, DKFZp686O24200, heat shock factor binding protein 1, heat shock factor-binding protein 1, HSF1BP, Nasopharyngeal carcinoma-associated antigen 13, NPC-A-13

Entrez Gene IDs

3281 (Human)

Gene Symbol

HSBP1

OMIM

604553 (Human)

UniProt

AAH07515 (Human)

Additional HSBP1 Products

Product Documents for HSBP1 Antibody (2C3) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HSBP1 Antibody (2C3) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HSBP1 Antibody (2C3) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review HSBP1 Antibody (2C3) - Azide and BSA Free and earn rewards!

Have you used HSBP1 Antibody (2C3) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies