HSD11B2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-37954

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HSD11B2 Antibody - BSA Free

Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37954]

Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37954]

Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37954] - Staining in human kidney and liver tissues using anti-HSD11B2 antibody. Corresponding HSD11B2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37954]

Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37954]

Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37954] - Staining of human kidney, liver, lymph node and rectum using Anti-HSD11B2 antibody NBP2-37954 (A) shows similar protein distribution across tissues to independent antibody NBP2-37898 (B).
Immunocytochemistry/ Immunofluorescence: HSD11B2 Antibody [NBP2-37954]

Immunocytochemistry/ Immunofluorescence: HSD11B2 Antibody [NBP2-37954]

Immunocytochemistry/Immunofluorescence: HSD11B2 Antibody [NBP2-37954] - Immunofluorescent staining of human cell line RT4 shows localization to vesicles.
Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37954]

Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37954]

Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37954] - Staining of human lymph node.
Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37954]

Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37954]

Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37954] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37954]

Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37954]

Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37954] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37954]

Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37954]

Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37954] - Staining of human rectum.

Applications for HSD11B2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 11 beta-HSD2

HSD11B2 catalyzes the conversion of cortisol to the inactive metabolite cortisone. The protein modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids. Defects in HSD11B2 are the cause of apparent mineralocorticoid excess (AME). AME is a potentially fatal disease characterized by severe juvenile low-renin hypertension, sodium retention, hypokalemia and low levels of aldosterone. It often leads to nephrocalcinosis.

Long Name

11 beta Hydroxysteroid Dehydrogenase 2

Alternate Names

11 betaHSD2, HSD11B2

Gene Symbol

HSD11B2

UniProt

Additional 11 beta-HSD2 Products

Product Documents for HSD11B2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HSD11B2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HSD11B2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HSD11B2 Antibody - BSA Free and earn rewards!

Have you used HSD11B2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...