HSD17B12 Antibody (4G11) - Azide and BSA Free

Novus Biologicals | Catalog # H00051144-M08

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 4G11

Format

Azide and BSA Free
View all HSD17B12 Primary Antibodies »

Product Specifications

Immunogen

HSD17B12 (NP_057226, 203 a.a. ~ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG

Specificity

Reacts with hydroxysteroid (17-beta) dehydrogenase 12.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Scientific Data Images for HSD17B12 Antibody (4G11) - Azide and BSA Free

Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08]

Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08]

Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08] - Analysis of HSD17B12 expression in NIH/3T3.
Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08]

Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08]

Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08] - Analysis of HSD17B12 expression in PC-12.
Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08]

Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08]

Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08] - Analysis of HSD17B12 expression in Jurkat (Cat # L017V1).
Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08]

Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08]

Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08] - Analysis of HSD17B12 expression in human ovarian cancer.
Sandwich ELISA: HSD17B12 Antibody (4G11) [H00051144-M08] - Detection limit for recombinant GST tagged HSD17B12 is 0.3 ng/ml as a capture antibody.

Applications for HSD17B12 Antibody (4G11) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is reactive against cell lysate for western blot and recombinant protein in ELISA.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: HSD17B12

The enzyme 17-beta hydroxysteroid dehydrogenase-12 (HSD17B12) uses NADPH to reduce 3-ketoacyl-CoA to 3-hydroxyacyl-CoA during the second step of fatty acid elongation.[supplied by OMIM]

Alternate Names

17-beta-HSD 12, 17-beta-hydroxysteroid dehydrogenase 12, EC 1.1.1.62,3-ketoacyl-CoA reductase, EC 1.3.1.-, hydroxysteroid (17-beta) dehydrogenase 12,17beta-HSD type 12, KARestradiol 17-beta-dehydrogenase 12, SDR12C1, short chain dehydrogenase/reductase family 12C, member 1, steroid dehydrogenase homolog

Entrez Gene IDs

51144 (Human)

Gene Symbol

HSD17B12

UniProt

NP_057226 (Human)

Additional HSD17B12 Products

Product Documents for HSD17B12 Antibody (4G11) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HSD17B12 Antibody (4G11) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HSD17B12 Antibody (4G11) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review HSD17B12 Antibody (4G11) - Azide and BSA Free and earn rewards!

Have you used HSD17B12 Antibody (4G11) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies