HSD17B4 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-85296
Loading...
Key Product Details
Validated by
Independent Antibodies
Species Reactivity
Validated:
Human
Cited:
Human, Mouse
Predicted:
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for HSD17B4 Antibody - BSA Free
Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296]
Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human liver, lung, lymph node and testis using Anti-HSD17B4 antibody NBP1-85296 (A) shows similar protein distribution across tissues to independent antibody NBP1-85297 (B).Immunocytochemistry/ Immunofluorescence: HSD17B4 Antibody [NBP1-85296]
Immunocytochemistry/Immunofluorescence: HSD17B4 Antibody [NBP1-85296] - Staining of human cell line A-431 shows localization to peroxisomes. Antibody staining is shown in green.Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296]
Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human lung.Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296]
Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human liver.Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296]
Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human testis.Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296]
Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human lymph node.Applications for HSD17B4 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Reviewed Applications
Read 1 review rated 4 using NBP1-85296 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: HSD17B4
Alternate Names
12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase, 7-alpha, D-bifunctional protein, EDH17B4, hydroxysteroid (17-beta) dehydrogenase 4, MPF-2, peroxisomal, peroxisomal multifunctional enzyme type 2,17-beta-HSD IV, peroxisomal multifunctional protein 2,17beta-estradiol dehydrogenase type IV, short chain dehydrogenase/reductase family 8C, member 1,3-alpha
Gene Symbol
HSD17B4
Additional HSD17B4 Products
Product Documents for HSD17B4 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for HSD17B4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for HSD17B4 Antibody - BSA Free
Customer Reviews for HSD17B4 Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used HSD17B4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: 20 micro gram and 20 ug whole cell lysateSpecies: human embryonic kidney 293 cells and HumanVerified Customer | Posted 12/12/201820 microgram of HEK293T whole cell lysate was loaded on the SDS-PAGE gel, and the endogenous of Hsd17b4 was probed by the anti-Hsd17b4 rabbit NBP1-85296 antibody.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...