HspA1L Antibody (1B5) - Azide and BSA Free

Novus Biologicals | Catalog # H00003305-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1B5

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

HSPA1L (NP_005518, 561 a.a. ~ 641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD

Specificity

HSPA1L - heat shock 70kDa protein 1-like (1B5)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for HspA1L Antibody (1B5) - Azide and BSA Free

Western Blot: HspA1L Antibody (1B5) [H00003305-M01]

Western Blot: HspA1L Antibody (1B5) [H00003305-M01]

Western Blot: HspA1L Antibody (1B5) [H00003305-M01] - HSPA1L monoclonal antibody (M01), clone 1B5. Analysis of HSPA1L expression in PC-12.
Western Blot: HspA1L Antibody (1B5) [H00003305-M01]

Western Blot: HspA1L Antibody (1B5) [H00003305-M01]

Western Blot: HspA1L Antibody (1B5) [H00003305-M01] - HSPA1L monoclonal antibody (M01), clone 1B5. Analysis of HSPA1L expression in HeLa.

Applications for HspA1L Antibody (1B5) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: HspA1L

This gene encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein.

Alternate Names

heat shock 10kDa protein 1-like, Heat shock 70 kDa protein 1-Hom, Heat shock 70 kDa protein 1L, heat shock 70 kDa protein 1-like, heat shock 70kD protein-like 1, heat shock 70kDa protein 1-like, HSP70-1L, HSP70-Hom, HSP70T, hum70t

Entrez Gene IDs

3305 (Human)

Gene Symbol

HSPA1L

Additional HspA1L Products

Product Documents for HspA1L Antibody (1B5) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HspA1L Antibody (1B5) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HspA1L Antibody (1B5) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review HspA1L Antibody (1B5) - Azide and BSA Free and earn rewards!

Have you used HspA1L Antibody (1B5) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...