HspA1L Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92012

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HspA1L Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KLYQGGCTGPACGTGYVPGRPATGPTIEEVD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HspA1L Antibody - BSA Free

Western Blot: HspA1L Antibody [NBP1-92012]

Western Blot: HspA1L Antibody [NBP1-92012]

Western Blot: HspA1L Antibody [NBP1-92012] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012]

Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012]

Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012]

Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012]

Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012]

Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012]

Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012]

Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012]

Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human prostate shows no positivity in glandular cells as expected.
HspA1L Antibody - BSA Free Western Blot: HspA1L Antibody - BSA Free [NBP1-92012]

Western Blot: HspA1L Antibody - BSA Free [NBP1-92012]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HspA1L Antibody - BSA Free Western Blot: HspA1L Antibody - BSA Free [NBP1-92012]

Western Blot: HspA1L Antibody - BSA Free [NBP1-92012]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
HspA1L Antibody - BSA Free Immunohistochemistry: HspA1L Antibody - BSA Free [NBP1-92012]

Immunohistochemistry: HspA1L Antibody - BSA Free [NBP1-92012]

Analysis in human testis and endometrium tissues using NBP1-92012 antibody. Corresponding HSPA1L RNA-seq data are presented for the same tissues.

Applications for HspA1L Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HspA1L

HSPA1L encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein.

Alternate Names

heat shock 10kDa protein 1-like, Heat shock 70 kDa protein 1-Hom, Heat shock 70 kDa protein 1L, heat shock 70 kDa protein 1-like, heat shock 70kD protein-like 1, heat shock 70kDa protein 1-like, HSP70-1L, HSP70-Hom, HSP70T, hum70t

Gene Symbol

HSPA1L

Additional HspA1L Products

Product Documents for HspA1L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HspA1L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for HspA1L Antibody - BSA Free

Customer Reviews for HspA1L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HspA1L Antibody - BSA Free and earn rewards!

Have you used HspA1L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HspA1L Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: Does the protein array contain other HSP70 (HSP70/HSPA1A)?

    A: The proteins used in their protein array analysis is proprietary; however based on a blast of the immunogen, the closest homology to any other HSP is 59% to HSPA2.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies