HspBP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17868

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HspBP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HspBP1 Antibody - BSA Free

Western Blot: HspBP1 Antibody [NBP3-17868]

Western Blot: HspBP1 Antibody [NBP3-17868]

Western Blot: HspBP1 Antibody [NBP3-17868] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil
Immunocytochemistry/ Immunofluorescence: HspBP1 Antibody [NBP3-17868]

Immunocytochemistry/ Immunofluorescence: HspBP1 Antibody [NBP3-17868]

Immunocytochemistry/Immunofluorescence: HspBP1 Antibody [NBP3-17868] - Staining of human cell line A549 shows localization to cytosol & centrosome.

Applications for HspBP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HspBP1

Heat shock protein binding protein is an Hsp70-interacting protein that was first isolated from a human heart cDNA library using the yeast two-hybrid system. HspBP1 binds the ATPase domain of Hsp70, and inhibits Hsp70 chaperone activity. More recently HspBP1 was found to promote nucleotide dissociation from Hsc70 and is capable of altering the confirmation of the Hsp70 ATPase domain. HspBP1 is capable of regulating any Hsp70 activity that requires ATPase.

Alternate Names

FES1, Heat shock protein-binding protein 1, Hsp70 binding protein 1, hsp70 interacting protein, hsp70-binding protein 1, Hsp70-binding protein 2, Hsp70-interacting protein 1, Hsp70-interacting protein 2, HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1, HSPBP, HspBP1, hspBP2

Gene Symbol

HSPBP1

Additional HspBP1 Products

Product Documents for HspBP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HspBP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HspBP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HspBP1 Antibody - BSA Free and earn rewards!

Have you used HspBP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies