Hyaluronan synthase 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-03787

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Hyaluronan synthase 2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 67-185 of human Hyaluronan synthase 2 (NP_005319.1). EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSEDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETDESHKESSQHVTQLVLSNKSICIMQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Hyaluronan synthase 2 Antibody - BSA Free

Hyaluronan synthase 2 Antibody

Western Blot: Hyaluronan synthase 2 Antibody [NBP3-03787] -

Western Blot: Hyaluronan synthase 2 Antibody [NBP3-03787] - Analysis of various lysates, using HAS2 antibody at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. xposure time: 180s.

Applications for Hyaluronan synthase 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Hyaluronan synthase 2

The HAS2 gene encodes a 552 amino acid long, 63 kDA hyaluronan synthase 2 protein that functions in hyaluronan/hyaluronic acid (HA) synthesis which is critical to the extracellular matrix. HAS2 is involved in hyaluronan metabolism, MPSII (Hunter syndrome), and MPS VI (Maroteaux-Lamy syndrome). HAS2 is also linked to arthropathy, fibrosarcoma, endometrial cancer, osteoarthritis, myeloma, benign tumors, breast cancer, ovarian cancer, and colon carcinoma.

Alternate Names

EC 2.4.1.212, HA synthase 2, hyaluronan synthase 2, Hyaluronate synthase 2, Hyaluronic acid synthase 2, MGC126241, MGC126242

Gene Symbol

HAS2

Additional Hyaluronan synthase 2 Products

Product Documents for Hyaluronan synthase 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Hyaluronan synthase 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Hyaluronan synthase 2 Antibody - BSA Free

Customer Reviews for Hyaluronan synthase 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Hyaluronan synthase 2 Antibody - BSA Free and earn rewards!

Have you used Hyaluronan synthase 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies