iASPP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38879

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all iASPP Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: CNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for iASPP Antibody - BSA Free

Immunohistochemistry-Paraffin: iASPP Antibody [NBP2-38879]

Immunohistochemistry-Paraffin: iASPP Antibody [NBP2-38879]

Immunohistochemistry-Paraffin: iASPP Antibody [NBP2-38879] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.

Applications for iASPP Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: iASPP

ASPP proteins (ASPP1, ASPP2 and iASPP) represent a new family of p53 binding proteins. ASPP1 and ASPP2 bind and enhance p53-mediated apoptosis. In contrast, the third member, iASPP, functionally inactivates p53. iASPP (also called protein phosphatase 1 regulatory (inhibitor) subunit 13 like protein, Inhibitor of ASPP protein, Protein iASPP, PPP1R13B-like protein and NFkB-interacting protein 1) plays a central role in regulation of apoptosis and transcription via its interaction with NF-kappa-B and p53/TP53 proteins. iASPP blocks transcription of HIV-1 virus by inhibiting the action of both NF-kappa-B and SP1. This protein also inhibits p53/TP53 function, possibly by preventing the association between p53/TP53 and ASPP1 or ASPP2, and therefore suppressing the subsequent activation of apoptosis. iASPP is predominantly a cytoplasmic protein (isoform 1) but can also be found in the nucleus (isoform 2). iASPP is highly expressed in heart, placenta and prostate and is weakly expressed in brain, liver, skeletal muscle, testis and peripheral blood leukocyte. The N-terminal region of isoform 1 is required for cytoplasmic localization. Defects in iASPP may be a cause of certain breast cancers and the protein is overexpressed in many patients suffering from breast carcinomas and expressing a wild-type p53/TP53 protein.

Alternate Names

IASPPinhibitor of apoptosis stimulating protein of p53, Inhibitor of ASPP protein, NFkB-interacting protein 1, NKIP1, PPP1R13BL, PPP1R13B-like protein, Protein iASPP, protein phosphatase 1, regulatory (inhibitor) subunit 13 like, protein phosphatase 1, regulatory subunit 13 like, RAINFkB interacting protein 1, relA-associated inhibitor

Gene Symbol

PPP1R13L

UniProt

Q8WUF5 (Human)

Additional iASPP Products

Product Documents for iASPP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for iASPP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for iASPP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review iASPP Antibody - BSA Free and earn rewards!

Have you used iASPP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies