ID2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88630

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Predicted:

Rat (97%). Backed by our 100% Guarantee.

Applications

Validated:

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids:MEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG

Reactivity Notes

Reactivity in mouse reported in scientific literature (PMID: 23063798).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit ID2 Antibody - BSA Free (NBP1-88630) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-ID2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ID2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ID2 Antibody [NBP1-88630]

Immunocytochemistry/ Immunofluorescence: ID2 Antibody [NBP1-88630]

Immunocytochemistry/Immunofluorescence: ID2 Antibody [NBP1-88630] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies & cytosol. Antibody staining is shown in green.
ID2 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: ID2 Antibody - BSA Free [NBP1-88630]

Chromatin Immunoprecipitation-exo-Seq: ID2 Antibody - BSA Free [NBP1-88630]

ChIP-Exo-Seq composite graph for Anti-ID2 (NBP1-88630) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for ID2 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ID2

ID2 is encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene.

Long Name

Inhibitor of DNA Binding 2

Alternate Names

GIG8

Gene Symbol

ID2

Additional ID2 Products

Product Documents for ID2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ID2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ID2 Antibody - BSA Free

Customer Reviews for ID2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ID2 Antibody - BSA Free and earn rewards!

Have you used ID2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for ID2 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
    • Q: Why there are 2 dominantly expressed bands in the Western Blot? Are there 2 different constructs used for expression in the HEK cells? Has the antibody been tested with endogenous ID2?

      A: The ID2 overexpression lysate used for the western blot image of NBP1-88630 was NBL1-11814, which is supplied to us by a collaborator lab. As far as we know, there is only one construct expressing the ID2 protein. Since there are no bands in the negative control, we think that both bands detected in the lysate overexpressing the ID2 protein represent the target. I am sorry, but we have not investigated the identity of the two bands. Perhaps the lower band is a partially degraded version. We have received reports that NBP1-88630 has been successfully used in western blot with endogenous cell samples, although unfortunately we do not have the actual data. Nevertheless, the ICC/IF and IHC-P images for this antibody demonstrate that it can detect the endogenous protein.
Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies