IFI35 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35665

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all IFI35 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-288 of human IFI35 (NP_005524.2).

Sequence:
MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMMSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for IFI35 Antibody - BSA Free

IFI35 Antibody

Western Blot: IFI35 Antibody [NBP3-35665] -

Western Blot: IFI35 Antibody [NBP3-35665] - Western blot analysis of various lysates using IFI35 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for IFI35 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: IFI35

IFI35, also known as Interferon-induced 35 kDa protein, consists of 2 isoforms, a 286 amino acid isoform 1 that is 31.5 kDa and a 188 amino acid isoform that is 32 kDa, has nucleus subcellular location and can be found in a wide range of cell types, including fibroblasts, macrophages, and epithelial cells. Its function is not yet known. Studies of this protein are being performed on research about diverticulitis and ovarian cancer. This protein plays a role in interferon alpha/beta signaling, cytokine signaling in immune system, expression of IFN-induced genes, interferon signaling, and immune system pathways where it interacts with CLEC4G, BATF, PLEKHO1, NMI, and MAPK1.

Alternate Names

FLJ21753, Ifi-35, IFP 35, IFP35interferon-induced 35 kDa protein, interferon-induced protein 35

Gene Symbol

IFI35

Additional IFI35 Products

Product Documents for IFI35 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IFI35 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IFI35 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IFI35 Antibody - BSA Free and earn rewards!

Have you used IFI35 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies