IFN-alpha J1/IFNA7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84085

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all IFN-alpha 7/IFNA7 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human IFN-alpha J1/IFNA7. Peptide sequence: SLGCDLPQTHSLRNRRALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for IFN-alpha J1/IFNA7 Antibody - BSA Free

Western Blot: IFN-alpha J1/IFNA7 Antibody [NBP2-84085]

Western Blot: IFN-alpha J1/IFNA7 Antibody [NBP2-84085]

Western Blot: IFN-alpha J1/IFNA7 Antibody [NBP2-84085] - WB Suggested Anti-IFNA7 antibody Titration: 1 ug/mL. Sample Type: Human Fetal Lung

Applications for IFN-alpha J1/IFNA7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IFN-alpha 7/IFNA7

Interferon-alpha (IFN-alpha), also known as leukocyte interferon, represents a group of related but distinct proteins that share over 95% amino acid sequence homology. They are members of the type I interferon family which share a common cell surface receptor composed of two subunits, a 100 kDa ligand-binding subunit (IFN-alpha R2) and a 125 kDa ligand binding and signal transduction subunit (IFN-alpha R1) that is involved both in ligand binding and signal transduction. IFN-alpha has both anti-viral and immunomodulatory activities on target cells.

Long Name

Interferon alpha 7

Alternate Names

IFN-alpha J1, IFNA7, IFNalpha J1

Gene Symbol

IFNA7

Additional IFN-alpha 7/IFNA7 Products

Product Documents for IFN-alpha J1/IFNA7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IFN-alpha J1/IFNA7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Interferons

Customer Reviews for IFN-alpha J1/IFNA7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IFN-alpha J1/IFNA7 Antibody - BSA Free and earn rewards!

Have you used IFN-alpha J1/IFNA7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies