IFN-gamma R1/CD119 Antibody - BSA Free

Name: IFN-gamma R1/CD119 Antibody - BSA Free
Brand: Novus Biologicals
SKU: NBP2-49406
Price: 559 USD
Availability: InStock

Novus Biologicals | Catalog # NBP2-49406

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

View all IFN-gamma R1/CD119 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IFN-gamma R1/CD119 Antibody - BSA Free

Immunohistochemistry-Paraffin: IFN-gamma R1/CD119 Antibody [NBP2-49406]

Immunohistochemistry-Paraffin: IFN-gamma R1/CD119 Antibody [NBP2-49406] - Staining of human spleen shows strong membranous positivity in cells in red pulp.

Applications for IFN-gamma R1/CD119 Antibody - BSA Free

Application

Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IFN-gamma R1/CD119

IFN gamma receptor beta is part of the receptor for interferon gamma. This class II cytokine receptor pairs with CDw119 to form the IFN gamma receptor and is an integral part of the IFN gamma signal transduction pathway. CDw119 serves as the IFN gamma binding chain and associates with the IFN gamma beta chain which is required for receptor signaling. The extracellular portion of both the IFN gamma receptor alpha and beta chains must be species matched. The IFN gamma receptor beta chain is expressed on T and B cells, NK cells, monocytes/ macrophages, and fibroblasts. Binding of IFN gamma induces receptor dimerization, internalization, Jak1 and Jak2 protein kinase activation and, ultimately, STAT1 activation. It is also likely to interact with GAF. IFN gamma initiates and regulates a variety of immune responses and is required for signal transduction. Contains 2 fibronectin type III domains. Defects in IFN gamma Receptor beta are a cause of mendelian susceptibility to mycobacterial disease (MSMD), a rare condition that confers predisposition to illness caused by several mycobacteria strains.

Long Name

Interferon gamma Receptor 1

Alternate Names

CD119, IFN-gR1, IFNgammaR1, IFNGR1

Gene Symbol

IFNGR1

Additional IFN-gamma R1/CD119 Products

Product Documents for IFN-gamma R1/CD119 Antibody - BSA Free

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IFN-gamma R1/CD119 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.