IFT88 Antibody (6P4S5)

Name: IFT88 Antibody (6P4S5)
Brand: Novus Biologicals
SKU: NBP3-33370
Price: 449 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-33370

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 6P4S5

View all IFT88 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 534-833 of human IFT88 (NP_783195.2).

Sequence:
GLTYEKLNRLDEALDCFLKLHAILRNSAEVLYQIANIYELMENPSQAIEWLMQVVSVIPTDPQVLSKLGELYDREGDKSQAFQYYYESYRYFPCNIEVIEWLGAYYIDTQFWEKAIQYFERASLIQPTQVKWQLMVASCFRRSGNYQKALDTYKDTHRKFPENVECLRFLVRLCTDLGLKDAQEYARKLKRLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

93 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for IFT88 Antibody (6P4S5)

Western Blot: IFT88 Antibody (6P4S5) [NBP3-33370] -

Western Blot: IFT88 Antibody (6P4S5) [NBP3-33370] - Western blot analysis of various lysates, using IFT88 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for IFT88 Antibody (6P4S5)

Application

Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: IFT88

IFT88 encodes a member of the tetratrico peptide repeat (TPR) family. Mutations of a similar gene in mouse can cause polycystic kidney disease. Two transcript variants encoding distinct isoforms have been identified for this gene.

Alternate Names

D13S1056ETPR repeat protein 10, DAF19, hTg737, intraflagellar transport 88 homolog (Chlamydomonas), intraflagellar transport protein 88 homolog, MGC26259, polaris homolog, probe hTg737 (polycystic kidney disease, autosomal recessive), Recessive polycystic kidney disease protein Tg737 homolog, tetratricopeptide repeat domain 10, Tetratricopeptide repeat protein 10, TG737Tg737, TTC10

Gene Symbol

IFT88

Additional IFT88 Products

Product Documents for IFT88 Antibody (6P4S5)

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IFT88 Antibody (6P4S5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IFT88 Antibody (6P4S5)

There are currently no reviews for this product. Be the first to review IFT88 Antibody (6P4S5) and earn rewards!

Have you used IFT88 Antibody (6P4S5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image