IGSF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14119

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (99%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: IVMPTPKPELWAETNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTGSYHCHSWEEMAVSEPSE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IGSF1 Antibody - BSA Free

Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119]

Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119]

Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119] - Staining of human liver, lymph node, pituitary gland and testis using Anti-IGSF1 antibody NBP2-14119 (A) shows similar protein distribution across tissues to independent antibody NBP2-68582 (B).
Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119]

Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119]

Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119] - Staining of human liver.
Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119]

Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119]

Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119] - Staining of human pituitary gland shows strong membranous positivity in cells in anterior lobe.
Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119]

Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119]

Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119] - Staining of human testis.
Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119]

Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119]

Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119] - Staining of human lymph node.

Applications for IGSF1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IGSF1

IGSF1 is a gene that codes for a protein that works as a coreceptor in inhibin signaling and antagonizes activing A signaling and is necessary to control the effect of inhibin B during transcription, and is expressed highly in the pancreas, testis, and fetal liver, with a weaker expression in the heart, prostate, and small intestine. There are four isoforms of IGSF1, with lengths of 1336, 1327, 242, and 1341 amino acids and weights of approximately 149, 148, 27 and 149 kDa respectively. Current studies are being done on several disorders and diseases related to this gene including subacute sclerosing panencephalitis, Gaucher's disease, and prostatitis. IGSF1 has also been shown to have interactions with HECTD1, RANBP10, IGF1, ACVR1, and ACVR1B in pathways such as the signal transduction of Activin A pathway.

Long Name

Immunoglobulin Superfamily, Member 1

Alternate Names

CHTE, IGCD1, IGDC1, InhBP, p120, PGSF2

Gene Symbol

IGSF1

Additional IGSF1 Products

Product Documents for IGSF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IGSF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for IGSF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IGSF1 Antibody - BSA Free and earn rewards!

Have you used IGSF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...