IGSF6/DORA Antibody

Name: IGSF6/DORA Antibody
Brand: Novus Biologicals
SKU: NBP1-84060
Price: 569 USD
Availability: InStock

Novus Biologicals | Catalog # NBP1-84060

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

View all IGSF6/DORA Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids:KSNPLRNKEIKEDSQKKKSARRIFQEIAQELYHKRHVETNQQSEKDNNTYENRRVLSNYERP

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for IGSF6/DORA Antibody

Immunohistochemistry-Paraffin: IGSF6/DORA Antibody [NBP1-84060]

Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus tubules.

Western Blot: BAFF/BLyS/TNFSF13B Antibody [NBP1-84060]

Analysis in control (vector only transfected HEK293T lysate) and IGSF6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for IGSF6/DORA Antibody

Application

Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml

Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IGSF6/DORA

DORA stands for down-regulated by activation.The Immunoglobulin Superfamily (IgSF) is a group of proteins that are involved in the recognition, binding, or adhesion processes of cells. IgSF proteins got their name because they possess an immunoglobulin (Ig) domain. DORA is also known as protein Immunoglobulin superfamily member 6. Immunoglobulin Superfamily Member 6, IGSF6, has been localized to a locus linked with inflammatory bowel disease; however, studies have shown that it lacks an association to the condition.

Long Name

Immunoglobulin Superfamily, Member 6

Alternate Names

DORA

Gene Symbol

IGSF6

Additional IGSF6/DORA Products

Product Documents for IGSF6/DORA Antibody

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IGSF6/DORA Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Integrins and Associated Molecules

Customer Reviews for IGSF6/DORA Antibody

There are currently no reviews for this product. Be the first to review IGSF6/DORA Antibody and earn rewards!

Have you used IGSF6/DORA Antibody?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image