IL-18 BPa/IL18BP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38481

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin

Cited:

IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all IL-18 BPa Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: RLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IL-18 BPa/IL18BP Antibody - BSA Free

IL-18 BPa/IL18BP Antibody - BSA Free

Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] -

Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] - analysis in human lymph node and liver tissues using NBP2-38481 antibody. Corresponding IL18BP RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481]

Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481]

Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] - Staining of human pancreas shows low expression as expected.
IL-18 BPa/IL18BP Antibody - BSA Free

Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] -

Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] -Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
IL-18 BPa/IL18BP Antibody - BSA Free

Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] -

Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] -Staining of human skeletal muscle shows no positivity in myocytes.
IL-18 BPa/IL18BP Antibody - BSA Free

Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] -

Immunohistochemistry-Paraffin: IL-18 BPa/IL18BP Antibody [NBP2-38481] -Staining of human liver shows no cytoplasmic positivity in hepatocytes.

Applications for IL-18 BPa/IL18BP Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IL-18 BPa

IL-18BP which binds to IL-18, also known as interferon-gamma inducing factor (IGIF) which is a pro-inflammatory cytokine that belongs to the IL-1 family (1). IL-18 is a pleiotropic factor involved in the regulation of both innate and acquired immune responses, playing a key role in autoimmune, inflammatory, and infectious diseases (2). Interleukin-18 binding protein (IL18-BP) is an inhibitor of the pro-inflammatory cytokine IL18. The recombinant forms of IL18BP did not exhibit species specificity and prevented interleukin-18 binding to its receptor. In addition, they inhibited interleukine-18 dependent IFN-gamma production from KG-1 cells effectively. These results suggest that the interleukin-18 binding protein may possess interleukine-18 antagonist activity (3). IL-18 plays an important role in host defense against microbial pathogens. Many poxviruses encode homologous IL-18BP that neutralizes IL-18 activity. Data show that IL-18BP prevents IL-18 from binding to IL-18R by interacting with three residues that are part of the binding site for IL-18Ralpha (4).

Long Name

Interleukin 18 Binding Protein Isoform a

Alternate Names

IL18 BPa, IL18BP

Gene Symbol

IL18BP

UniProt

O95998

Additional IL-18 BPa Products

Product Documents for IL-18 BPa/IL18BP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IL-18 BPa/IL18BP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

IL-1 Family

Citations for IL-18 BPa/IL18BP Antibody - BSA Free

Customer Reviews for IL-18 BPa/IL18BP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IL-18 BPa/IL18BP Antibody - BSA Free and earn rewards!

Have you used IL-18 BPa/IL18BP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

IL-1 Family Signaling Pathways IL-1 Family Signaling Pathway Thumbnail