IL-1ra/IL-1F3/IL1RN Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-81616PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL1RN.

Source: E. coli

Amino Acid Sequence: ETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81616.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-81616PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: IL-1ra/IL-1F3

IL-1ra (IL-1 receptor antagonist) is a widely expressed acute phase protein that serves to dampen inflammation. IL-1ra binds to both IL-1 RI and IL-1 RII. It competitively inhibits IL-1 (alpha or beta) binding to IL-1 RI and does not trigger recruitment of the accessory molecule IL-1 R AcP or activation of IL-1 RI signaling. IL-1ra blocks the proinflammatory actions of IL-1 including Prostaglandin E2 and IL-6 release from endothelial cells, fever generation, thrombocytosis, the production of hepatic acute phase proteins, and neutrophil expansion and infiltration.

Long Name

Interleukin 1 Receptor Antagonist

Alternate Names

DIRA, ICIL-1ra, IL-1F3, IL-1ra3, IL-1RN, IL1ra, IL1RN, MVCD4

Gene Symbol

IL1RN

Additional IL-1ra/IL-1F3 Products

Product Documents for IL-1ra/IL-1F3/IL1RN Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IL-1ra/IL-1F3/IL1RN Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for IL-1ra/IL-1F3/IL1RN Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review IL-1ra/IL-1F3/IL1RN Recombinant Protein Antigen and earn rewards!

Have you used IL-1ra/IL-1F3/IL1RN Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...

Associated Pathways

IL-1 Family Signaling Pathways IL-1 Family Signaling Pathway Thumbnail