IL-36 gamma/IL-1F9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-24913

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all IL-36 gamma/IL-1F9 Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein IL-36 gamma/IL-1F9 using the following amino acid sequence: AFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IL-36 gamma/IL-1F9 Antibody - BSA Free

IL-36 gamma/IL-1F9 Antibody Immunocytochemistry/Immunofluorescence: IL-36 gamma/IL-1F9 Antibody [NBP3-24913]

Immunocytochemistry/Immunofluorescence: IL-36 gamma/IL-1F9 Antibody [NBP3-24913]

Staining of human cell line HaCaT shows localization to plasma membrane.

Applications for IL-36 gamma/IL-1F9 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IL-36 gamma/IL-1F9

Interleukin 36 gamma (IL-36 gamma), also known as IL-1F9 and IL-1H1 is a member of the IL-1 family. IL-36 gamma is secreted when transfected into 293-T cells. Cells reported to express IL-36 gamma include Langerhans cells, keratinocytes/stratified squamos epithelium, chief cells, and parietal cells. The receptor for IL-36 gamma is reported to be a combination of IL-1 R6/IL-1 R rp2 and IL-1 R3/IL-1 R AcP. Recombinant IL-36 gamma has been shown to activate pathways involving NF-kappa B and MAPK in an IL-1 R6/IL-1 R rp2-dependent manner.

Long Name

Interleukin 36 gamma/Interleukin 1 Family 9

Alternate Names

IL-1 H1, IL-1rp2, IL1F9, IL36 gamma, IL36G

Gene Symbol

IL36G

Additional IL-36 gamma/IL-1F9 Products

Product Documents for IL-36 gamma/IL-1F9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IL-36 gamma/IL-1F9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

IL-1 Family

Customer Reviews for IL-36 gamma/IL-1F9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IL-36 gamma/IL-1F9 Antibody - BSA Free and earn rewards!

Have you used IL-36 gamma/IL-1F9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

IL-1 Family Signaling Pathways IL-1 Family Signaling Pathway Thumbnail