ILT7/CD85g/LILRA4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48932

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LILRA4/CD85g/ILT7 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPSD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ILT7/CD85g/LILRA4 Antibody - BSA Free

Immunohistochemistry-Paraffin: ILT7/CD85g/LILRA4 Antibody [NBP2-48932]

Immunohistochemistry-Paraffin: ILT7/CD85g/LILRA4 Antibody [NBP2-48932]

Immunohistochemistry-Paraffin: ILT7/CD85g/LILRA4 Antibody [NBP2-48932] - Staining of human testis shows weak to moderate membranous positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: ILT7/CD85g/LILRA4 Antibody [NBP2-48932]

Immunohistochemistry-Paraffin: ILT7/CD85g/LILRA4 Antibody [NBP2-48932]

Immunohistochemistry-Paraffin: ILT7/CD85g/LILRA4 Antibody [NBP2-48932] - Staining of human lymph node shows moderate to strong positivity in lymphoid cells.
Immunohistochemistry-Paraffin: ILT7/CD85g/LILRA4 Antibody [NBP2-48932]

Immunohistochemistry-Paraffin: ILT7/CD85g/LILRA4 Antibody [NBP2-48932]

Immunohistochemistry-Paraffin: ILT7/CD85g/LILRA4 Antibody [NBP2-48932] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: ILT7/CD85g/LILRA4 Antibody [NBP2-48932]

Immunohistochemistry-Paraffin: ILT7/CD85g/LILRA4 Antibody [NBP2-48932]

Immunohistochemistry-Paraffin: ILT7/CD85g/LILRA4 Antibody [NBP2-48932] - Staining of human small intestine shows moderate membranous positivity in glandular cells.

Applications for ILT7/CD85g/LILRA4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LILRA4/CD85g/ILT7

ILT7 (immunoglobulin-like transcript 7) is a member of leukocyte immunoglobulin-like receptor (LIR or LILR) gene family, also known as CD85g and LILRA4. It contains four extracellular Ig domains. In association with Fc epsilonR1 gamma, ILT7 forms a receptor complex that transduces ITAM-mediated signals. ILT7 is specifically expressed on plasmacytoid dendritic cells (pDCs), but not on myeloid dendritic cells and other peripheral blood leukocytes. ILT7 negatively regulates the innate immune functions of human pDCs. Cross-linking 17G10.2 antibody is able to trigger ILT7 mediated signaling.

Long Name

Leukocyte Immunoglobulin-like Receptor, Subfamily A (with TM domain), Member 4

Alternate Names

CD85g, ILT7

Gene Symbol

LILRA4

Additional LILRA4/CD85g/ILT7 Products

Product Documents for ILT7/CD85g/LILRA4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ILT7/CD85g/LILRA4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ILT7/CD85g/LILRA4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ILT7/CD85g/LILRA4 Antibody - BSA Free and earn rewards!

Have you used ILT7/CD85g/LILRA4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies