IMPACT Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86221

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Predicted:

Rat (98%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ENKKIASATHNIYAYRIYCEDKQTFLQDCEDDGETAAGGRLLHLMEILNVKNVMVVV

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30466445).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IMPACT Antibody - BSA Free

Western Blot: IMPACT Antibody [NBP1-86221]

Western Blot: IMPACT Antibody [NBP1-86221]

IMPACT-Antibody-Western-Blot-NBP1-86221-img0012.jpg
Immunocytochemistry/ Immunofluorescence: IMPACT Antibody [NBP1-86221]

Immunocytochemistry/ Immunofluorescence: IMPACT Antibody [NBP1-86221]

Immunocytochemistry/Immunofluorescence: IMPACT Antibody [NBP1-86221] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: IMPACT Antibody [NBP1-86221]

Immunohistochemistry-Paraffin: IMPACT Antibody [NBP1-86221]

Immunohistochemistry-Paraffin: IMPACT Antibody [NBP1-86221] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: IMPACT Antibody [NBP1-86221]

Immunohistochemistry-Paraffin: IMPACT Antibody [NBP1-86221]

Immunohistochemistry-Paraffin: IMPACT Antibody [NBP1-86221] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: IMPACT Antibody [NBP1-86221]

Immunohistochemistry-Paraffin: IMPACT Antibody [NBP1-86221]

Immunohistochemistry-Paraffin: IMPACT Antibody [NBP1-86221] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.
IMPACT Antibody - BSA Free Western Blot: IMPACT Antibody - BSA Free [NBP1-86221]

Western Blot: IMPACT Antibody - BSA Free [NBP1-86221]

Analysis in control (vector only transfected HEK293T lysate) and IMPACT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
IMPACT Antibody - BSA Free

Western Blot: IMPACT Antibody - BSA Free [NBP1-86221] -

IMPACT overexpression confers GL261 glioma cells increased survival during tryptophan deprivation. a) Western blotting with indicated antibodies on GL261-wild-type and GL261-IMPACThigh lines cultured in standard media containing 50 μM tryptophan over a period of 8 days. Doubling time is shown as a mean +/- SD. b) Fluorescence microscopy images (20x objective) of GL261-wild-type and GL261-IMPACThigh lines stained with fluorescein diacetate and propidium iodide after five days of culture in media containing tryptophan concentrations ranging from 2.5 μM to 50 μM. c) Metabolic activity of GL261-wild-type and GL261-IMPACThigh lines determined using the MTT assay. Bar heights and whiskers represent a mean +/- SD of four replicates. Statistical significance was determined using Student’s t-test in Graphpad Prism v7.03. ***P < 0.001, **P < 0.01, ns P > 0.25 Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/30466445), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for IMPACT Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IMPACT

Translational regulator that ensures constant high levels of translation under amino acid starvation. Acts by interacting with GCN1/GCN1L1, thereby preventing activation of GCN2 protein kinases (EIF2AK1 to 4) and subsequent down-regulation of protein synthesis

Alternate Names

Impact homolog (mouse), Imprinted and ancient gene protein homolog, MGC33718, protein IMPACT

Gene Symbol

IMPACT

Additional IMPACT Products

Product Documents for IMPACT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IMPACT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for IMPACT Antibody - BSA Free

Customer Reviews for IMPACT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IMPACT Antibody - BSA Free and earn rewards!

Have you used IMPACT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...