ING3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86985

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ING3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human ING3. Peptide sequence: MDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ING3 Antibody - BSA Free

Western Blot: ING3 Antibody [NBP2-86985]

Western Blot: ING3 Antibody [NBP2-86985]

Western Blot: ING3 Antibody [NBP2-86985] - WB Suggested Anti-ING3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate

Applications for ING3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ING3

ING3 is encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers. Two alternatively spliced transcript variants encoding different isoforms have been observed. [provided by RefSeq]

Alternate Names

FLJ20089, ING2, inhibitor of growth family, member 3, inhibitor of growth protein 3, MEAF4, P47, p47ING3Eaf4

Gene Symbol

ING3

Additional ING3 Products

Product Documents for ING3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ING3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ING3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ING3 Antibody - BSA Free and earn rewards!

Have you used ING3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies