INMT Antibody (1I7K2)

Novus Biologicals | Catalog # NBP3-33252

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 1I7K2
View all INMT Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human INMT (O95050).

Sequence:
MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLGNPLA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for INMT Antibody (1I7K2)

INMT Antibody (1I7K2)

Western Blot: INMT Antibody (1I7K2) [NBP3-33252] -

Western Blot: INMT Antibody (1I7K2) [NBP3-33252] - Western blot analysis of various lysates using INMT Rabbit mAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for INMT Antibody (1I7K2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: INMT

INMT is a gene which codes for a protein that functions as a thioether S-methyltransferase which is necessary in the detoxification of selenium compounds and the catalyzation of the N-methylations of tryptamine and compounds with similar structures and has two isoforms with lengths of 263 and 262 amino acids, that both have a weight of approximately 29 kDa. Current studies are being done on diseases and disorders relating to this gene including appendicitis, homosydteine, thryoditis, and carcinoma. INMT has also been shown to interact with KCNMA1, FMO1, IDO1, AANAT, and ABP1 in pathways such as the tryptophan metabolism and selenocompound metabolism pathways.

Alternate Names

Amine N-methyltransferase, Aromatic alkylamine N-methyltransferase, Arylamine N-methyltransferase, EC 2.1.1, EC 2.1.1.49, Indolamine N-methyltransferase, indolethylamine N-methyltransferase, MGC125940, MGC125941, nicotine N-methyltransferase

Gene Symbol

INMT

Additional INMT Products

Product Documents for INMT Antibody (1I7K2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for INMT Antibody (1I7K2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for INMT Antibody (1I7K2)

There are currently no reviews for this product. Be the first to review INMT Antibody (1I7K2) and earn rewards!

Have you used INMT Antibody (1I7K2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies