Key Product Details

Species Reactivity

Validated:

Human, Porcine

Cited:

Porcine

Applications

Immunohistochemistry, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 Clone # 29A3

Format

BSA Free
Loading...

Product Specifications

Immunogen

Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the Integrin alpha 3/CD49c including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Reactivity Notes

A broad species reactivity is expected based on the conserved nature of the epitope. Use in Porcine reported in scientific literature (PMID:32211117).

Specificity

This antibody recognizes specifically the cytoplasmic domain of Integrin alpha 3/CD49c which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Description

The antibody is shipped at ambient temperature and may be stored at 4C. For prolonged storage prepare appropriate aliquots and store at or below -20C. Prior to use, an aliquot is thawed slowly in the dark at ambient temperature, spun down again and used to prepare working dilutions by adding sterile phosphate buffered saline (PBS, pH 7.2). Repeated thawing and freezing should be avoided. Working dilutions should be stored at 4C, not refrozen, and preferably used the same day. If a slight precipitation occurs upon storage, this should be removed by centrifugation. It will not affect the performance or the concentration of the product.

Scientific Data Images for Integrin alpha 3/CD49c Antibody (29A3) - BSA Free

Immunocytochemistry/ Immunofluorescence: Integrin alpha 3/CD49c Antibody (29A3) - BSA Free [NBP1-97692]

Immunocytochemistry/ Immunofluorescence: Integrin alpha 3/CD49c Antibody (29A3) - BSA Free [NBP1-97692]

Immunocytochemistry/Immunofluorescence: Integrin alpha 3 Antibody (29A3) [NBP1-97692] - Immunohistochemistry on frozen section of human kidney

Applications for Integrin alpha 3/CD49c Antibody (29A3) - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10-1:500

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Frozen

1:100-1:200

Western Blot

1:100-1:1000
Application Notes
This antibody is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titration; recommended range is 1:100 - 1:200 for immunohistochemistry with avidin-biotinylated Horseradish peroxidase complex (ABC) as detection reagent, and 1:100 - 1:1000 for immunoblotting applications..

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

PBS, pH 7.2

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Integrin alpha 3/CD49c

Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins. The alpha 3 beta 1 integrin is known variously as: very late (activation) antigen 3 (VLA3), very common antigen 2 (VCA2), extracellular matrix receptor 1 (ECMR1), and galactoprotein b3 (GAPB3).

Alternate Names

CD49c, ITGA3

Gene Symbol

ITGA3

Additional Integrin alpha 3/CD49c Products

Product Documents for Integrin alpha 3/CD49c Antibody (29A3) - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Integrin alpha 3/CD49c Antibody (29A3) - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Integrin alpha 3/CD49c Antibody (29A3) - BSA Free

Customer Reviews for Integrin alpha 3/CD49c Antibody (29A3) - BSA Free

There are currently no reviews for this product. Be the first to review Integrin alpha 3/CD49c Antibody (29A3) - BSA Free and earn rewards!

Have you used Integrin alpha 3/CD49c Antibody (29A3) - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies