Integrin alpha 5/CD49e Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-84576
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human, Mouse
Cited:
Human, Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Immunohistochemistry-Paraffin, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWA
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Integrin alpha 5/CD49e Antibody - BSA Free
Immunohistochemistry-Paraffin: Integrin alpha 5/CD49e Antibody [NBP1-84576]
Immunohistochemistry-Paraffin: Integrin alpha 5/CD49e Antibody [NBP1-84576] - Staining in human placenta and skeletal muscle tissues using anti-ITGA5 antibody. Corresponding ITGA5 RNA-seq data are presented for the same tissues.Immunohistochemistry-Paraffin: Integrin alpha 5/CD49e Antibody [NBP1-84576]
Immunohistochemistry-Paraffin: Integrin alpha 5/CD49e Antibody [NBP1-84576] - Staining of human endometrium shows weak to moderate membranous positivity in smooth muscle cells.Immunohistochemistry-Paraffin: Integrin alpha 5/CD49e Antibody [NBP1-84576]
Immunohistochemistry-Paraffin: Integrin alpha 5/CD49e Antibody [NBP1-84576] - Staining of human placenta shows high expression.Immunohistochemistry-Paraffin: Integrin alpha 5/CD49e Antibody [NBP1-84576]
Immunohistochemistry-Paraffin: Integrin alpha 5/CD49e Antibody [NBP1-84576] - Staining of human skeletal muscle shows low expression as expected.Immunohistochemistry-Paraffin: Integrin alpha 5/CD49e Antibody [NBP1-84576]
Immunohistochemistry-Paraffin: Integrin alpha 5/CD49e Antibody [NBP1-84576] - Staining of human prostate shows moderate membranous positivity in smooth muscle cells.Western Blot: Integrin alpha 5/CD49e Antibody - BSA Free [NBP1-84576]
Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.Applications for Integrin alpha 5/CD49e Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviewed Applications
Read 1 review rated 4 using NBP1-84576 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Integrin alpha 5/CD49e
Additional Integrin alpha 5/CD49e Products
Product Documents for Integrin alpha 5/CD49e Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Integrin alpha 5/CD49e Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Integrin alpha 5/CD49e Antibody - BSA Free
Customer Reviews for Integrin alpha 5/CD49e Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used Integrin alpha 5/CD49e Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: MDA-MB-231 Cell LysateSpecies: HumanVerified Customer | Posted 10/10/2012
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars