Integrin beta-like protein 1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82473
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Mouse
Predicted:
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGV
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Integrin beta-like protein 1 Antibody - BSA Free
Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473]
Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473] - Staining of human colorectal cancer shows moderate positivity.Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473]
Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473] - Staining of human lung shows strong cytoplasmic positivity in macrophages.Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473]
Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473]
Immunohistochemistry-Paraffin: Integrin beta-like protein 1 Antibody [NBP1-82473] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.Immunohistochemistry: Integrin beta-like protein 1 Antibody - BSA Free [NBP1-82473] -
ITGBL1 expression is upregulated in HCC tissues and associated with the prognosis of HCC patients. A, ITGBL1 expression in the normal liver tissues (n = 50) and primary liver tumour tissues (n = 371), as revealed by the TCGA HCC data set (P <.001). B, ITGBL1 expression in the normal liver (n = 19) and HCC tissues (n = 47), as revealed by the Oncomine database (GSE14323; P <.001). C, Different ITGBL1 mRNA expression levels in 22 paired samples of HCC tumour tissues and adjacent non‐cancerous tissues, as determined by RT‐PCR analyses (P =.0057). D, Western blotting analyses of the ITGBL1 protein expression levels in eight randomly selected tumour tissues and the matched adjacent non‐tumour tissues from HCC patients; GAPDH was used as the internal loading control. E, Greyscale analysis of the ITGBL1 expression level, compared to the GAPDH expression level, in the eight patients (P <.001). T, tumour tissue; N, normal tissue. F, Immunochemistry staining of ITGBL1 in the TMAs with HCC tissues and adjacent non‐cancerous tissues (n = 98; P <.001). G, The Kaplan‐Meier plot for the overall survival of HCC patients according to ITGBL1 expression levels (higher vs lower, log‐rank test, P =.014) Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/32537856), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for Integrin beta-like protein 1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ITGBL1
Long Name
Integrin beta-like 1
Alternate Names
Integrin beta-like 1, OSCP, TIED
Gene Symbol
ITGBL1
Additional ITGBL1 Products
Product Documents for Integrin beta-like protein 1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Integrin beta-like protein 1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Integrin beta-like protein 1 Antibody - BSA Free
Customer Reviews for Integrin beta-like protein 1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Integrin beta-like protein 1 Antibody - BSA Free and earn rewards!
Have you used Integrin beta-like protein 1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...