INTS11 Antibody (3E7S3)

Novus Biologicals | Catalog # NBP3-33376

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 3E7S3
View all INTS11 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 331-600 of human INTS11 (NP_060341.2).

Sequence:
GQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKGLPQAPS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for INTS11 Antibody (3E7S3)

INTS11 Antibody (3E7S3)

Western Blot: INTS11 Antibody (3E7S3) [NBP3-33376] -

Western Blot: INTS11 Antibody (3E7S3) [NBP3-33376] - Western blot analysis of various lysates, using INTS11 Rabbit mAb at 1:6000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for INTS11 Antibody (3E7S3)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:2000 - 1:7000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: INTS11

INT11 has been identified as a component of the twelve-subunit integrator complex that functions in RNA Pol II mediated 3'-end mRNA processing of the U1 and U2 small nuclear RNAs (snRNAs). INT11 is a beta-lactamase family member that has sequence similarity to the cleavage and polyadenylation specificity factors CPSF-73 and CPSF-100.

Alternate Names

cleavage and polyadenylation specific factor 3-like, Cleavage and polyadenylation-specific factor 3-like protein, CPSF3-like protein, EC 3.1.27, EC 3.1.27.-, FLJ20542, INT11, integrator complex subunit 11, INTS11FLJ13294, Protein related to CPSF subunits of 68 kDa, RC68, RC-68CPSF73L, related to CPSF subunits 68 kDa

Gene Symbol

INTS11

Additional INTS11 Products

Product Documents for INTS11 Antibody (3E7S3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for INTS11 Antibody (3E7S3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for INTS11 Antibody (3E7S3)

There are currently no reviews for this product. Be the first to review INTS11 Antibody (3E7S3) and earn rewards!

Have you used INTS11 Antibody (3E7S3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies