IP3R1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37937

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1812-1911 of human IP3R1 (NP_001365381).

Sequence:
SFFCRLTEDKKSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

314 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for IP3R1 Antibody - BSA Free

IP3R1 Antibody

Immunohistochemistry: IP3R1 Antibody [NBP3-37937] -

Immunohistochemistry: IP3R1 Antibody [NBP3-37937] - Perform microwave antigen retrievalwith 10 mM citrate buffer pH 6.0before commencing with IF stainingprotocol.Immunofluorescenceanalysis of paraffin-embedded RatBrain using IP3R Rabbit pAb(A21471) at dilution of 1:200 (40xlens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG(H+L) (AS007) at 1:500 dilution. Blue:DAPI for nuclear staining.
IP3R1 Antibody

Immunoprecipitation: IP3R1 Antibody [NBP3-37937] -

Immunoprecipitation: IP3R1 Antibody [NBP3-37937] - Immunoprecipitation of IP3R1 from 500 ug extracts of SH-SY5Y cells was performed using 2 ug of IP3R1 Rabbit pAb was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western Blot analysis of immunoprecipitates was conducted using IP3R1 Rabbit pAb at a dilution of 1:2500.
IP3R1 Antibody

Western Blot: IP3R1 Antibody [NBP3-37937] -

Western Blot: IP3R1 Antibody [NBP3-37937] - Western Blot analysis of various lysates using IP3R1 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Negative control (NC): A-431.
Exposure time: 10s.

Applications for IP3R1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunoprecipitation

1:50 - 1:200

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: IP3R1

IP3R1 (inositol 1,4,5-triphosphate receptor type 1) is an intracellular calcium release channel that mediates calcium release from the endoplasmic reticulum. There are 3 mammalian InsP3R receptors: Insp3R1, Insp3R2, and Insp3R3. Defects in the gene which encodes InsP3R1, ITPR1, are the cause of spinocerebellar ataxia type 15 (SCA15).

Long Name

Inositol 1,4,5-trisphosphate receptor type 1

Alternate Names

InsP3R1, IP3R 1, ITPR1

Gene Symbol

ITPR1

Additional IP3R1 Products

Product Documents for IP3R1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IP3R1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IP3R1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IP3R1 Antibody - BSA Free and earn rewards!

Have you used IP3R1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...