IRX1 Antibody (1A11) - Azide and BSA Free

Novus Biologicals | Catalog # H00079192-M04-100ug

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1A11

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

IRX1 (NP_077313, 424 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NGDKASVRSSPTLPERDLVPRPDSPAQQLKSPFQPVRDNSLAPQEGTPRILAALPS

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for IRX1 Antibody (1A11) - Azide and BSA Free

Western Blot: IRX1 Antibody (1A11) [H00079192-M04-100ug]

Western Blot: IRX1 Antibody (1A11) [H00079192-M04-100ug]

Western Blot: IRX1 Antibody (1A11) [H00079192-M04-100ug] - Detection against Immunogen (31.9 KDa).
ELISA: IRX1 Antibody (1A11) [H00079192-M04-100ug]

ELISA: IRX1 Antibody (1A11) [H00079192-M04-100ug]

ELISA: IRX1 Antibody (1A11) [H00079192-M04-100ug] - Detection limit for recombinant GST tagged IRX1 is 0.03 ng/ml as a capture antibody.

Applications for IRX1 Antibody (1A11) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: IRX1

The Iroquois homeobox gene family of transcription factors regulate aspects of embryonic development including anterior/posterior and dorsal/ventral axis patterning in the central nervous system. The Iroquois family are clustered on two loci, IRXA and IRXB, which map to chromosomes 8 and 13 in mice. The IRXA group includes Irx1, Irx2 and Irx4; the IRXB group is comprises Irx3, Irx5 and Irx6. Irx1 and Irx2 are both widely expressed during development in the lung epithelium and also in the ventricular septum. Irx1 and Irx2 also play a role in digit formation (E11.5-E14.5). The Irx gene family members are each expressed in a distinct pattern during mouse heart development. Specifically, Irx1 and Irx2 are expressed in the ventricular septum and Irx3 is expressed in the ventricular trabeculated myocardium. In addition, Irx4 is expressed in the linear heart tube and the AV canal; Irx5 is expressed in the endocardium lining the ventricular and atrial myocardium. Furthermore, the IRX4 gene may modulate cardiac development and function. Although the heart of Irx4- mice appears to develop normally, adult Irx4- mice exhibit cardiomyopathy, including cardiac hypertrophy and decreased contractility.

Alternate Names

Homeodomain protein IRXA1, iroquois homeobox 1, Iroquois homeobox protein 1, iroquois-class homeodomain protein IRX-1, IRX-5, IRXA1

Entrez Gene IDs

79192 (Human)

Gene Symbol

IRX1

OMIM

606197 (Human)

Additional IRX1 Products

Product Documents for IRX1 Antibody (1A11) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IRX1 Antibody (1A11) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IRX1 Antibody (1A11) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review IRX1 Antibody (1A11) - Azide and BSA Free and earn rewards!

Have you used IRX1 Antibody (1A11) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...