JPH1 Antibody (2E6) - Azide and BSA Free

Novus Biologicals | Catalog # H00056704-M04

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2E6

Format

Azide and BSA Free
View all JPH1 Primary Antibodies »

Product Specifications

Immunogen

JPH1 (NP_065698, 501 a.a. ~ 579 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VADEQVTAIVNKPLMSKAPTKEAGAVVPQSKYSGRHHIPNPSNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSA

Reactivity Notes

Human. Other species not tested.

Specificity

JPH1 (2E6)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for JPH1 Antibody (2E6) - Azide and BSA Free

ELISA: JPH1 Antibody (2E6) [H00056704-M04]

ELISA: JPH1 Antibody (2E6) [H00056704-M04]

ELISA: JPH1 Antibody (2E6) [H00056704-M04] - Detection limit for recombinant GST tagged JPH1 is approximately 0.03ng/ml as a capture antibody.

Applications for JPH1 Antibody (2E6) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: JPH1

Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. The protein encoded by this gene is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane. This gene is a member of the junctophilin gene family.

Alternate Names

DKFZp762L0313, JP-1junctophilin type1, JP1junctophilin-1, junctophilin 1, Junctophilin type 1, mitsugumin72

Entrez Gene IDs

56704 (Human)

Gene Symbol

JPH1

OMIM

605266 (Human)

UniProt

NP_065698 (Human)

Additional JPH1 Products

Product Documents for JPH1 Antibody (2E6) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for JPH1 Antibody (2E6) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for JPH1 Antibody (2E6) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review JPH1 Antibody (2E6) - Azide and BSA Free and earn rewards!

Have you used JPH1 Antibody (2E6) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies