KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80270

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human GRIK5. Peptide sequence EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free

Western Blot: KA2/GRIK5/Glutamate Receptor KA2 Antibody [NBP1-80270]

Western Blot: KA2/GRIK5/Glutamate Receptor KA2 Antibody [NBP1-80270]

Western Blot: KA2/GRIK5/Glutamate Receptor KA2 Antibody [NBP1-80270] - Jurkat cell lysate. Suggested Antibody Titration: 0.2 - 1 ug/mL.

Immunohistochemistry-Paraffin: KA2/GRIK5/Glutamate Receptor KA2 Antibody [NBP1-80270] -

Immunohistochemistry-Paraffin: KA2/GRIK5/Glutamate Receptor KA2 Antibody [NBP1-80270] - FFPE Human Pineal Tissue. Primary antibody at 1:100.

Immunohistochemistry: KA2/GRIK5/Glutamate Receptor KA2 Antibody [NBP1-80270] -

Immunohistochemistry: KA2/GRIK5/Glutamate Receptor KA2 Antibody [NBP1-80270] - Mouse Retina, 25 ug/mL.
KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free

Western Blot: KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free [NBP1-80270] -

Altered abundance of glutamate receptor subunits in HPC synaptosomes from Dp1Tyb, Dp(17)3Yey, and Dp(10)2Yey male mice. (A–C) HPC synaptosomes from the indicated mouse strains were analyzed by immunoblotting for glutamate receptor subunits and PSD95. Example immunoblots are shown on the left and mean +/- SEM protein abundance on the right, normalized to beta -actin (or to GluA1 or GluN2B in case of phosphorylation levels of the respective receptor) and then to the mean signal in WT mice. Immunoblots show analysis of HPC synaptosome extracts from 2 to 5 mice of each genotype. Compared to WT littermates, mutant Dp1Tyb mice displayed lower hippocampal expression of GluA1, pGluA1(S845), and PSD95 (Student’s t-test, *p < 0.05) (A). Mutant Dp(10)2Yey mice displayed an age-dependent decrease in hippocampal expression of GluK5 and PSD95 compared to WT littermates (two-way ANOVA, *p < 0.05, **p < 0.001) (C). The decrease in GluK5 expression was not driven by age-dependent changes in the WT group as this comparison was not statistically significant (p > 0.05) (C). 21-month-old Dp1Tyb: n = 6 WT, 5 Dp1Tyb; 21-month-old Dp(17)3Yey: n = 9 WT, 12 Dp(17)3Yey; 14-month-old Dp(10)2Yey: n = 9 WT, 11 Dp(10)2Yey; 22-month-old Dp(10)2Yey: n = 6 WT, 10 Dp(10)2Yey. Image collected and cropped by CiteAb from the following open publication (https://www.frontiersin.org/articles/10.3389/fnbeh.2024.1428146/full), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free

Western Blot: KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free [NBP1-80270] -

Altered abundance of glutamate receptor subunits in HPC synaptosomes from Dp1Tyb, Dp(17)3Yey, and Dp(10)2Yey male mice. (A–C) HPC synaptosomes from the indicated mouse strains were analyzed by immunoblotting for glutamate receptor subunits and PSD95. Example immunoblots are shown on the left and mean +/- SEM protein abundance on the right, normalized to beta -actin (or to GluA1 or GluN2B in case of phosphorylation levels of the respective receptor) and then to the mean signal in WT mice. Immunoblots show analysis of HPC synaptosome extracts from 2 to 5 mice of each genotype. Compared to WT littermates, mutant Dp1Tyb mice displayed lower hippocampal expression of GluA1, pGluA1(S845), and PSD95 (Student’s t-test, *p < 0.05) (A). Mutant Dp(10)2Yey mice displayed an age-dependent decrease in hippocampal expression of GluK5 and PSD95 compared to WT littermates (two-way ANOVA, *p < 0.05, **p < 0.001) (C). The decrease in GluK5 expression was not driven by age-dependent changes in the WT group as this comparison was not statistically significant (p > 0.05) (C). 21-month-old Dp1Tyb: n = 6 WT, 5 Dp1Tyb; 21-month-old Dp(17)3Yey: n = 9 WT, 12 Dp(17)3Yey; 14-month-old Dp(10)2Yey: n = 9 WT, 11 Dp(10)2Yey; 22-month-old Dp(10)2Yey: n = 6 WT, 10 Dp(10)2Yey. Image collected and cropped by CiteAb from the following open publication (https://www.frontiersin.org/articles/10.3389/fnbeh.2024.1428146/full), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free

Western Blot: KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free [NBP1-80270] -

Altered abundance of glutamate receptor subunits in HPC synaptosomes from Dp1Tyb, Dp(17)3Yey, and Dp(10)2Yey male mice. (A–C) HPC synaptosomes from the indicated mouse strains were analyzed by immunoblotting for glutamate receptor subunits and PSD95. Example immunoblots are shown on the left and mean +/- SEM protein abundance on the right, normalized to beta -actin (or to GluA1 or GluN2B in case of phosphorylation levels of the respective receptor) and then to the mean signal in WT mice. Immunoblots show analysis of HPC synaptosome extracts from 2 to 5 mice of each genotype. Compared to WT littermates, mutant Dp1Tyb mice displayed lower hippocampal expression of GluA1, pGluA1(S845), and PSD95 (Student’s t-test, *p < 0.05) (A). Mutant Dp(10)2Yey mice displayed an age-dependent decrease in hippocampal expression of GluK5 and PSD95 compared to WT littermates (two-way ANOVA, *p < 0.05, **p < 0.001) (C). The decrease in GluK5 expression was not driven by age-dependent changes in the WT group as this comparison was not statistically significant (p > 0.05) (C). 21-month-old Dp1Tyb: n = 6 WT, 5 Dp1Tyb; 21-month-old Dp(17)3Yey: n = 9 WT, 12 Dp(17)3Yey; 14-month-old Dp(10)2Yey: n = 9 WT, 11 Dp(10)2Yey; 22-month-old Dp(10)2Yey: n = 6 WT, 10 Dp(10)2Yey. Image collected and cropped by CiteAb from the following open publication (https://www.frontiersin.org/articles/10.3389/fnbeh.2024.1428146/full), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KA2/GRIK5

Glutamate receptor KA2 is a protein that interacts with glutamate, an excitatory neurotransmitter, in the central nervous system and that has two isoforms, measuring 980 and 981 amino acids in length, with weights of approximately 109 and 110 kDa respectively. Current studies are being done on diseases and disorders related to this protein including temporal lobe epilepsy, embryonal carcinoma, Parkinson's disease, schizophrenia, retinoblastoma, neruoblastoma, thyroiditis, and neuronitis. Glutamate receptor KA2 has also been shown to have interactions with GOLM1, GPAA1, LRSAM1, DLG4, and GRID2 in pathways such as the glutamic acid signaling, transmission across chemical synapses, and activation of kainite receptor pathways.

Long Name

Glutamate Receptor KA2

Alternate Names

EAA2, GluK5, GRIK2, GRIK5

Gene Symbol

GRIK5

UniProt

Additional KA2/GRIK5 Products

Product Documents for KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free

Customer Reviews for KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free and earn rewards!

Have you used KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...