KCNA7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-24934

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein KCNA7 using the following amino acid sequence: TEGEEAGMFSHVDMQPCGPLEGKANGGLVDGEV

Reactivity Notes

Mouse, Rat (88%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KCNA7 Antibody - BSA Free

KCNA7 Antibody Immunocytochemistry/Immunofluorescence: KCNA7 Antibody [NBP3-24934]

Immunocytochemistry/Immunofluorescence: KCNA7 Antibody [NBP3-24934]

Staining of human cell line SiHa shows localization to vesicles.

Applications for KCNA7 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KCNA7

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. The gene is expressed preferentially in skeletal muscle, heart and kidney. It is a candidate gene for inherited cardiac disorders.

Long Name

Potassium voltage-gated channel subfamily A member 7

Alternate Names

HAK6, Kv1.7, potassium voltage-gated channel subfamily A member 7, potassium voltage-gated channel, shaker-related subfamily, member 7, voltage-dependent potassium channel Kv1.7, voltage-gated potassium channel KCNA7, Voltage-gated potassium channel subunit Kv1.7

Gene Symbol

KCNA7

Additional KCNA7 Products

Product Documents for KCNA7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KCNA7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KCNA7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KCNA7 Antibody - BSA Free and earn rewards!

Have you used KCNA7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...