Recombinant Human KCNJ10 GST (N-Term) Protein

Novus Biologicals | Catalog # H00003766-Q01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray
Loading...

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 276-379 of Human KCNJ10

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

37.18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human KCNJ10 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00003766-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: KCNJ10

KCNJ10 - potassium inwardly-rectifying channel, subfamily J, member 10

Long Name

ATP-sensitive inward rectifier potassium channel 10

Alternate Names

ATP-dependent inwardly rectifying potassium channel Kir4.1, ATP-sensitive inward rectifier potassium channel 10, BIRK-10, glial ATP-dependent inwardly rectifying potassium channel KIR4.1, Inward rectifier K(+) channel Kir1.2, inward rectifier K+ channel KIR1.2, KCNJ13-PEN, Kir1.2, KIR4.1, Potassium channel, inwardly rectifying subfamily J member 10, potassium inwardly-rectifying channel, subfamily J, member 10, SESAME

Gene Symbol

KCNJ10

Additional KCNJ10 Products

Product Documents for Recombinant Human KCNJ10 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human KCNJ10 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human KCNJ10 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human KCNJ10 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human KCNJ10 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Human KCNJ10 GST (N-Term) Protein

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I would like to know which specific peptide sequence are detected by the antibody? It is only stated in the data sheet that it reacts against a part of the C-terminal part of KIR4.1. Also, do you know if this antibody or any of your other antibodies could be utilized as an intracellular staining of cells for flow cytometry? Furthermore, I have seen in the data sheet for the synthetic peptide that it is not suitable for use with live cells, but is this an absolute? If this is the case, would it possible to buy a similar peptide which could be used with live cells, and if so at which prize/amount? Lastly, are the peptide in a frozen liquid form (or solid powder) with out trace of azide? When it comes to the cell lysate I'm wondering if this could be utilized with live cells or if the RIPA buffer which it is dissolved in makes this very toxic? If the last is the case, is it possible to provide the lysate in another buffer which are appropriate for live cells? Lastly, I wondered if the transfected HEK293T cells are also sold for culture?

    A: This partial recombinant protein is produced by a company in Taiwan called Abnova. We distribute their products in addition to selling our own. They have confirmed that this protein has not been tested with live cells, so we do not know whether it would be suitable or not, and that it is supplied frozen, in an azide-free buffer. Unfortunately, an alternative protein/peptide of KCNJ10 is not available. I think this product is supplied frozen not lyophilized, and the buffer is 50 mM Tris-HCI, 10 mM reduced glutathione, pH 8.0.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...