KIF14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55378

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all KIF14 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MKLSMMIQEANAISSKLKTYYVFGRHDISDKSSSDTSIRVRNLKLGISTFWSLEKFESKLAAMKELYESNGSNRGEDA

Reactivity Notes

Mouse 81%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KIF14 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: KIF14 Antibody [NBP2-55378]

Immunocytochemistry/ Immunofluorescence: KIF14 Antibody [NBP2-55378]

Immunocytochemistry/Immunofluorescence: KIF14 Antibody [NBP2-55378] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.

Applications for KIF14 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KIF14

The kinesin superfamily proteins (KIFs) are microtubule-dependent molecular motors that transport membranous organelles and protein complexes in a microtubule and ATP-dependent manner. Cells use KIFs to tightly control the direction, destination and speed of the transportation of a variety of important functional molecules, including mRNA. KIFs are involved in neuronal function and development. Kinesin family member 14 (KIF14) is an overexpressed potential oncogene in the 1q region of genomic gain in breast cancer cell lines associated with poor prognosis breast cancer. The gain of chromosome 1q likely reflects oncogene amplification. As such KIF14 may be a potential therapeutic target and indicator of oncogenesis.

Alternate Names

KIAA0042MGC142302, kinesin family member 14, kinesin-like protein KIF14

Gene Symbol

KIF14

Additional KIF14 Products

Product Documents for KIF14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KIF14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KIF14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KIF14 Antibody - BSA Free and earn rewards!

Have you used KIF14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies