KIF1C Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35601

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all KIF1C Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 810-960 of human KIF1C (NP_006603.2).

Sequence:
EEGGGAGSGGGSEEGARGAEVEDLRAHIDKLTGILQEVKLQNSSKDRELQALRDRMLRMERVIPLAQDHEDENEEGGEVPWAPPEGSEAAEEAAPSDRMPSARPPSPPLSSWERVSRLMEEDPAFRRGRLRWLKQEQLRLQGLQGSGGRGG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

123 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KIF1C Antibody - BSA Free

KIF1C Antibody

Western Blot: KIF1C Antibody [NBP3-35601] -

Western Blot: KIF1C Antibody [NBP3-35601] - Western blot analysis of various lysates using KIF1C Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.

Applications for KIF1C Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: KIF1C

The kinesin superfamily of proteins consists of over forty KIF motor proteins that function in intracellular transport along microtubules. Kinesin activity has been linked to various cellular functions such as vesicle transport, mitotic spindle formation, chromosome segregation, and cytokinesis. Structurally, all kinesins contain a motor domain with microtubule and nucleotide binding sites that utilize ATP to target cargo along microtubule filaments. KIF1C, also known as LTXS1 (lethal toxin sensitivity), has been found to be localized to the golgi and the endoplasmic reticulum (ER) and play a role in vesicle transport between the golgi and ER. Alternate identifiers of KIF1C include kinesin family member 1C, kinesin-like protein KIF1C and KIAA0706.

Alternate Names

KIAA0706, kinesin family member 1C, kinesin-like protein KIF1C, LTXS1

Gene Symbol

KIF1C

Additional KIF1C Products

Product Documents for KIF1C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KIF1C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KIF1C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KIF1C Antibody - BSA Free and earn rewards!

Have you used KIF1C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies