Kindlin Antibody [Biotin]

Novus Biologicals | Catalog # NBP3-65655

Fc Region Site-Specific Biotinylated Antibody
Novus Biologicals

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG
View all Kindlin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ADSLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Additional information may be available upon request. The antibody concentration is provided on the individual product label. For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Applications for Kindlin Antibody [Biotin]

Application
Recommended Usage

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Recommended applications and dilutions are based on validated applications from the unconjugated base product NBP1-70338.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

40% glycerol and PBS (pH 7.2).

Preservative

0.02% Sodium Azide

Concentration

0.1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: Kindlin

Due to a concerted effort to identify biomarkers for lung and colon carcinomas by genome-wide transcriptional profiling, the identification and cloning of one such gene as well as two additional closely related genes was achieved. Due to the strong sequence homology to the C. elegans UNC-112 a novel gene gene was named URP1, for UNC-112 related protein. Another novel related gene, URP2 and the previously discovered MIG-2 gene was also identified. Transcriptional analysis shows that only URP1 is significantly differentially regulated, being over-expressed in 70% of the colon carcinomas and 60% of the lung carcinomas tested. Quantification of URP1 expression by qRT-PCR showed up-regulation of the gene by 60-fold in lung tumors and up to nearly 6-fold in colon tumors. Northern blot analysis of URP1 indicates that normal expression is restricted to neuromuscular tissues. In contrast, the expression of URP2 appears to be confined primarily to tissues of the immune system. URP1 has the potential to be one of the most important prognostic and diagnostic markers of colon or lung cancer.

Alternate Names

C20orf42fermitin family homolog 1, chromosome 20 open reading frame 42, fermitin family homolog 1 (Drosophila), fermitin family member 1, FLJ20116, KIND1DTGCU2, Kindlerin, kindlin 1, Kindlin syndrome protein, Kindlin-1, UNC112 related protein 1, UNC112A, Unc-112-related protein 1, URP1FLJ23423

Gene Symbol

FERMT1

Additional Kindlin Products

Product Documents for Kindlin Antibody [Biotin]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Kindlin Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kindlin Antibody [Biotin]

There are currently no reviews for this product. Be the first to review Kindlin Antibody [Biotin] and earn rewards!

Have you used Kindlin Antibody [Biotin]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies