Kinesin 5A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85344

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Kinesin 5A Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Kinesin 5A Antibody - BSA Free

Western Blot: Kinesin 5A Antibody [NBP1-85344]

Western Blot: Kinesin 5A Antibody [NBP1-85344]

Western Blot: Kinesin 5A Antibody [NBP1-85344] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry: Kinesin 5A Antibody [NBP1-85344]

Immunohistochemistry: Kinesin 5A Antibody [NBP1-85344]

Immunohistochemistry: Kinesin 5A Antibody [NBP1-85344] - Staining of mouse hippocampus shows positivity in a subset of neurons.
Western Blot: Kinesin 5A Antibody [NBP1-85344]

Western Blot: Kinesin 5A Antibody [NBP1-85344]

Western Blot: Kinesin 5A Antibody [NBP1-85344] - Analysis in human cerebral cortex tissue.
Immunohistochemistry-Paraffin: Kinesin 5A Antibody [NBP1-85344]

Immunohistochemistry-Paraffin: Kinesin 5A Antibody [NBP1-85344]

Immunohistochemistry-Paraffin: Kinesin 5A Antibody [NBP1-85344] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.
Immunohistochemistry-Paraffin: Kinesin 5A Antibody [NBP1-85344]

Immunohistochemistry-Paraffin: Kinesin 5A Antibody [NBP1-85344]

Immunohistochemistry-Paraffin: Kinesin 5A Antibody [NBP1-85344] - Staining of human hippocampus shows positivity in subsets of neuronal cells.
Immunohistochemistry-Paraffin: Kinesin 5A Antibody [NBP1-85344]

Immunohistochemistry-Paraffin: Kinesin 5A Antibody [NBP1-85344]

Immunohistochemistry-Paraffin: Kinesin 5A Antibody [NBP1-85344] - Staining of human cerebellum shows cytoplasmic immunoreactivity in Purkinje cells, as well as positivity in the molecular and granular cell layers.
Immunohistochemistry: Kinesin 5A Antibody [NBP1-85344]

Immunohistochemistry: Kinesin 5A Antibody [NBP1-85344]

Immunohistochemistry: Kinesin 5A Antibody [NBP1-85344] - Staining of mouse red nucleus shows immunoreactivity in neuronal cell bodies.
Immunohistochemistry: Kinesin 5A Antibody [NBP1-85344]

Immunohistochemistry: Kinesin 5A Antibody [NBP1-85344]

Immunohistochemistry: Kinesin 5A Antibody [NBP1-85344] - Staining of mouse olfactory bulb shows positivity in mitral cell layer neurons and processes in plexiform layer.
Immunohistochemistry: Kinesin 5A Antibody [NBP1-85344]

Immunohistochemistry: Kinesin 5A Antibody [NBP1-85344]

Immunohistochemistry: Kinesin 5A Antibody [NBP1-85344] - Staining of mouse lateral septum shows immunoreactivity in a subset of neurons.

Applications for Kinesin 5A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kinesin 5A

Kinesin 5A is part of a superfamily of microtubule-associated motor proteins involved in a variety of cellular processes including membranous organelle transport and cell division. Kinesin has been found in a variety of organisms and cell types and is subject to spatial and temporal regulation. These proteins have a modular structure including a conserved motor domain of approximately 350 amino acids, which is responsible for microtubule binding and ATP hydrolysis. In addition to the motor domain, subfamily members share common domain organization, exhibit sequence similarity, motility properties, and cellular functions outside of the motor domain. There are currently three known Kinesin 5 family members denoted as A, B, and C. Kinesin 5A and kinesin 5C appear to be exclusively neuronal, whereas kinesin 5B appears to be ubiquitous in its expression.

Alternate Names

D12S1889, KIF5A variant protein, kinesin family member 5A, kinesin heavy chain isoform 5A, Kinesin heavy chain neuron-specific 1, kinesin, heavy chain, neuron-specific, MY050, Neuronal kinesin heavy chain, NKHC1, NKHCspastic paraplegia 10 (autosomal dominant), SPG10

Gene Symbol

KIF5A

Additional Kinesin 5A Products

Product Documents for Kinesin 5A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Kinesin 5A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kinesin 5A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kinesin 5A Antibody - BSA Free and earn rewards!

Have you used Kinesin 5A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies